Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9WRC9

Protein Details
Accession W9WRC9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
450-473GPSSVVRVHRRGHKRKHGHQDGRLBasic
NLS Segment(s)
PositionSequence
459-467RRGHKRKHG
Subcellular Location(s) extr 23, nucl 1, mito 1, pero 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018535  DUF1996  
Pfam View protein in Pfam  
PF09362  DUF1996  
Amino Acid Sequences MATLRVKLKTSLMLLVSPFFAGPATAFFRHLCHGELGNGRVDPIVAPGNPSQHLHVIFGASNVGLDPTLEELLASNCTSCSILQDHSVYWTPRMYFQHGNSTFEMVPTSGGITVYYFTEPDPVFKDPVTAFPQNFRMVAGNSMKRAFLGPNPDPPMSNWDVNDKSQPQLMEKALGFNCLNYGAQPEGARQYHYMRNKTFLDDQCTDGIRAEVMFPSCWNGKDLDSDDHTSHVAYPNAVQNGKCPDGYPVRLPTLFYETIYQTNIFAGMDGQFTFSNGDPTGYGYHGDFMCAWDAGVLQGAIDSPACNLPQQASGNQDDCPIFDLQEVDAGTQCKMEIPEILQNEPINLIQQLPGNVQIQAGTGSATMGPMPGATAPAARPVPSANFTALSTPAVPTAGPTASMSTSPPATTLSPCTSKSQHTTTTAFMSNGVMINMVLVEEVVTVTVSDGPSSVVRVHRRGHKRKHGHQDGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.25
4 0.2
5 0.17
6 0.12
7 0.11
8 0.08
9 0.08
10 0.1
11 0.15
12 0.16
13 0.18
14 0.19
15 0.21
16 0.24
17 0.25
18 0.23
19 0.21
20 0.22
21 0.25
22 0.29
23 0.29
24 0.29
25 0.28
26 0.26
27 0.22
28 0.21
29 0.15
30 0.14
31 0.16
32 0.13
33 0.17
34 0.18
35 0.22
36 0.24
37 0.25
38 0.25
39 0.25
40 0.26
41 0.24
42 0.23
43 0.21
44 0.2
45 0.19
46 0.17
47 0.11
48 0.1
49 0.09
50 0.08
51 0.06
52 0.05
53 0.06
54 0.07
55 0.08
56 0.07
57 0.07
58 0.07
59 0.09
60 0.11
61 0.1
62 0.08
63 0.08
64 0.09
65 0.1
66 0.1
67 0.12
68 0.12
69 0.14
70 0.17
71 0.19
72 0.18
73 0.21
74 0.26
75 0.24
76 0.23
77 0.25
78 0.22
79 0.27
80 0.31
81 0.33
82 0.35
83 0.36
84 0.45
85 0.44
86 0.47
87 0.42
88 0.42
89 0.36
90 0.29
91 0.27
92 0.16
93 0.15
94 0.11
95 0.11
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.07
105 0.13
106 0.13
107 0.15
108 0.18
109 0.19
110 0.2
111 0.19
112 0.23
113 0.17
114 0.23
115 0.27
116 0.27
117 0.26
118 0.28
119 0.33
120 0.31
121 0.3
122 0.25
123 0.21
124 0.18
125 0.23
126 0.26
127 0.24
128 0.25
129 0.26
130 0.25
131 0.23
132 0.24
133 0.2
134 0.16
135 0.22
136 0.22
137 0.29
138 0.34
139 0.34
140 0.33
141 0.32
142 0.36
143 0.31
144 0.31
145 0.24
146 0.25
147 0.27
148 0.28
149 0.32
150 0.27
151 0.24
152 0.25
153 0.25
154 0.2
155 0.23
156 0.22
157 0.21
158 0.19
159 0.24
160 0.21
161 0.24
162 0.22
163 0.17
164 0.17
165 0.15
166 0.14
167 0.09
168 0.11
169 0.08
170 0.09
171 0.09
172 0.1
173 0.14
174 0.15
175 0.16
176 0.15
177 0.19
178 0.25
179 0.31
180 0.36
181 0.32
182 0.37
183 0.37
184 0.39
185 0.42
186 0.38
187 0.39
188 0.34
189 0.35
190 0.32
191 0.32
192 0.28
193 0.21
194 0.18
195 0.11
196 0.09
197 0.08
198 0.07
199 0.07
200 0.07
201 0.06
202 0.09
203 0.1
204 0.11
205 0.11
206 0.11
207 0.11
208 0.14
209 0.16
210 0.16
211 0.18
212 0.2
213 0.19
214 0.18
215 0.18
216 0.15
217 0.13
218 0.13
219 0.11
220 0.09
221 0.1
222 0.12
223 0.15
224 0.15
225 0.14
226 0.14
227 0.19
228 0.2
229 0.18
230 0.15
231 0.17
232 0.2
233 0.22
234 0.23
235 0.21
236 0.22
237 0.22
238 0.22
239 0.2
240 0.22
241 0.2
242 0.18
243 0.17
244 0.16
245 0.17
246 0.17
247 0.16
248 0.1
249 0.1
250 0.1
251 0.07
252 0.06
253 0.05
254 0.05
255 0.06
256 0.05
257 0.07
258 0.06
259 0.07
260 0.09
261 0.08
262 0.09
263 0.09
264 0.09
265 0.08
266 0.1
267 0.1
268 0.09
269 0.1
270 0.08
271 0.11
272 0.1
273 0.1
274 0.09
275 0.09
276 0.09
277 0.09
278 0.08
279 0.06
280 0.06
281 0.05
282 0.06
283 0.04
284 0.03
285 0.03
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.06
292 0.06
293 0.07
294 0.07
295 0.08
296 0.13
297 0.15
298 0.16
299 0.18
300 0.2
301 0.21
302 0.21
303 0.23
304 0.18
305 0.16
306 0.17
307 0.14
308 0.11
309 0.11
310 0.11
311 0.09
312 0.12
313 0.12
314 0.09
315 0.11
316 0.12
317 0.11
318 0.11
319 0.1
320 0.09
321 0.09
322 0.1
323 0.09
324 0.11
325 0.16
326 0.18
327 0.19
328 0.2
329 0.19
330 0.19
331 0.18
332 0.16
333 0.12
334 0.1
335 0.1
336 0.09
337 0.11
338 0.12
339 0.12
340 0.15
341 0.15
342 0.14
343 0.14
344 0.12
345 0.11
346 0.11
347 0.1
348 0.07
349 0.06
350 0.06
351 0.06
352 0.06
353 0.05
354 0.05
355 0.05
356 0.04
357 0.05
358 0.04
359 0.05
360 0.06
361 0.07
362 0.07
363 0.13
364 0.14
365 0.14
366 0.15
367 0.16
368 0.2
369 0.21
370 0.22
371 0.18
372 0.18
373 0.18
374 0.2
375 0.18
376 0.16
377 0.14
378 0.13
379 0.12
380 0.11
381 0.1
382 0.1
383 0.12
384 0.1
385 0.11
386 0.11
387 0.12
388 0.13
389 0.14
390 0.14
391 0.13
392 0.15
393 0.14
394 0.14
395 0.14
396 0.15
397 0.17
398 0.21
399 0.24
400 0.28
401 0.3
402 0.35
403 0.36
404 0.4
405 0.44
406 0.44
407 0.45
408 0.46
409 0.46
410 0.43
411 0.45
412 0.42
413 0.36
414 0.3
415 0.25
416 0.22
417 0.2
418 0.17
419 0.12
420 0.09
421 0.09
422 0.08
423 0.07
424 0.05
425 0.04
426 0.04
427 0.04
428 0.04
429 0.04
430 0.04
431 0.04
432 0.05
433 0.08
434 0.08
435 0.08
436 0.08
437 0.1
438 0.11
439 0.13
440 0.16
441 0.21
442 0.27
443 0.33
444 0.4
445 0.49
446 0.59
447 0.68
448 0.75
449 0.79
450 0.84
451 0.88
452 0.93
453 0.94