Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VI07

Protein Details
Accession W9VI07   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
35-63APDAPPTNKPKKEKAPKQPKPPKAPAAPAHydrophilic
NLS Segment(s)
PositionSequence
42-60NKPKKEKAPKQPKPPKAPA
Subcellular Location(s) cyto 21, cyto_nucl 13.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
Amino Acid Sequences MADSSAPEKDVPADVKAALNHEIADNVKSNTSAAAPDAPPTNKPKKEKAPKQPKPPKAPAAPAAPVSPALIDLRVGHILRAIAHPNADSLYVSTIAMGDAEGTEHTHVDEETGKVVRTVCSGLNGLIPLEEMQNRKVVVVANLKPVNMRSIKSAAMVLAASPPAKEGADPHAADRIVELVNPPERAEAGDAVFFEGWPYGEGKGPEKQLNPKKKVWESVQPGFFTSDDLAVGFDAGRPGVEIDGEKDKKGWLVVEGKGRCTVKTLKGAVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.23
4 0.24
5 0.22
6 0.2
7 0.18
8 0.17
9 0.18
10 0.16
11 0.17
12 0.17
13 0.15
14 0.16
15 0.15
16 0.15
17 0.14
18 0.14
19 0.12
20 0.11
21 0.15
22 0.15
23 0.17
24 0.22
25 0.22
26 0.25
27 0.33
28 0.41
29 0.44
30 0.5
31 0.57
32 0.63
33 0.73
34 0.79
35 0.83
36 0.84
37 0.86
38 0.92
39 0.93
40 0.92
41 0.9
42 0.89
43 0.86
44 0.81
45 0.78
46 0.72
47 0.67
48 0.59
49 0.51
50 0.43
51 0.34
52 0.28
53 0.22
54 0.16
55 0.11
56 0.09
57 0.08
58 0.08
59 0.07
60 0.09
61 0.12
62 0.12
63 0.11
64 0.12
65 0.12
66 0.13
67 0.15
68 0.15
69 0.12
70 0.13
71 0.13
72 0.12
73 0.12
74 0.11
75 0.09
76 0.07
77 0.08
78 0.08
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.05
85 0.04
86 0.03
87 0.03
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.09
99 0.09
100 0.09
101 0.1
102 0.11
103 0.1
104 0.1
105 0.11
106 0.09
107 0.1
108 0.11
109 0.1
110 0.1
111 0.1
112 0.08
113 0.07
114 0.07
115 0.05
116 0.06
117 0.08
118 0.08
119 0.09
120 0.11
121 0.11
122 0.11
123 0.12
124 0.11
125 0.13
126 0.19
127 0.19
128 0.24
129 0.25
130 0.25
131 0.24
132 0.24
133 0.24
134 0.19
135 0.18
136 0.15
137 0.16
138 0.17
139 0.17
140 0.17
141 0.12
142 0.11
143 0.1
144 0.08
145 0.06
146 0.06
147 0.06
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.07
154 0.11
155 0.17
156 0.17
157 0.17
158 0.2
159 0.2
160 0.2
161 0.19
162 0.16
163 0.1
164 0.1
165 0.1
166 0.1
167 0.13
168 0.13
169 0.13
170 0.12
171 0.12
172 0.13
173 0.14
174 0.11
175 0.09
176 0.1
177 0.1
178 0.11
179 0.1
180 0.09
181 0.08
182 0.07
183 0.07
184 0.06
185 0.07
186 0.07
187 0.1
188 0.11
189 0.14
190 0.18
191 0.22
192 0.26
193 0.29
194 0.38
195 0.45
196 0.55
197 0.58
198 0.59
199 0.64
200 0.65
201 0.69
202 0.65
203 0.65
204 0.63
205 0.65
206 0.65
207 0.56
208 0.52
209 0.46
210 0.4
211 0.32
212 0.25
213 0.17
214 0.12
215 0.11
216 0.1
217 0.08
218 0.08
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.08
228 0.08
229 0.11
230 0.21
231 0.23
232 0.23
233 0.23
234 0.24
235 0.24
236 0.25
237 0.23
238 0.19
239 0.23
240 0.27
241 0.36
242 0.38
243 0.38
244 0.44
245 0.43
246 0.38
247 0.37
248 0.39
249 0.37
250 0.44
251 0.45