Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9W7D1

Protein Details
Accession W9W7D1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-65VISCLTCGRRKRTHRSTRTRTHTTSRVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 8, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences SQFESICRTIGSVLMAIVNGIGSILTAIINGIVSLFDIVISCLTCGRRKRTHRSTRTRTHTTSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.05
6 0.04
7 0.03
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.03
25 0.03
26 0.04
27 0.04
28 0.04
29 0.06
30 0.09
31 0.14
32 0.2
33 0.28
34 0.37
35 0.46
36 0.57
37 0.66
38 0.75
39 0.81
40 0.86
41 0.89
42 0.9
43 0.9
44 0.88
45 0.83