Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JUU0

Protein Details
Accession A0A0D8JUU0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25NETAACKSRMRKKPWGKALGERSSHydrophilic
NLS Segment(s)
PositionSequence
10-27RMRKKPWGKALGERSSPG
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
KEGG cim:CIMG_13119  -  
Amino Acid Sequences MNETAACKSRMRKKPWGKALGERSSPGKRVTSRHMGTDVIPPVKEGTPKYSFSGETSFLARNASASRPIRVRTRITLIAQKGFSALGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.85
4 0.79
5 0.79
6 0.81
7 0.77
8 0.68
9 0.6
10 0.55
11 0.5
12 0.48
13 0.4
14 0.36
15 0.32
16 0.35
17 0.39
18 0.44
19 0.41
20 0.41
21 0.4
22 0.36
23 0.33
24 0.34
25 0.31
26 0.22
27 0.2
28 0.18
29 0.18
30 0.18
31 0.19
32 0.14
33 0.17
34 0.19
35 0.21
36 0.23
37 0.23
38 0.23
39 0.22
40 0.24
41 0.2
42 0.17
43 0.18
44 0.17
45 0.15
46 0.16
47 0.14
48 0.12
49 0.13
50 0.13
51 0.19
52 0.2
53 0.24
54 0.27
55 0.31
56 0.37
57 0.4
58 0.44
59 0.41
60 0.47
61 0.48
62 0.49
63 0.54
64 0.51
65 0.52
66 0.47
67 0.41
68 0.35