Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VUQ1

Protein Details
Accession W9VUQ1   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-70RPAAKAGKPKRGRNPRPKAKTAEBasic
NLS Segment(s)
PositionSequence
27-67KAQPKSATAPKKVVGKDSAKGRPAAKAGKPKRGRNPRPKAK
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MFQHRLQPSHLRNVLRTQTQNNRANPKAQPKSATAPKKVVGKDSAKGRPAAKAGKPKRGRNPRPKAKTAEELDAEMTDYWGGNNPAAAATNTDAAATNGAAPAPTTGEDAMEEISVSDIEFIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.54
4 0.51
5 0.56
6 0.63
7 0.68
8 0.66
9 0.68
10 0.63
11 0.64
12 0.62
13 0.63
14 0.6
15 0.56
16 0.53
17 0.49
18 0.55
19 0.59
20 0.6
21 0.53
22 0.5
23 0.5
24 0.54
25 0.5
26 0.46
27 0.43
28 0.39
29 0.4
30 0.43
31 0.45
32 0.4
33 0.42
34 0.39
35 0.35
36 0.36
37 0.36
38 0.33
39 0.38
40 0.41
41 0.49
42 0.55
43 0.59
44 0.66
45 0.72
46 0.77
47 0.78
48 0.84
49 0.84
50 0.84
51 0.82
52 0.78
53 0.71
54 0.69
55 0.61
56 0.54
57 0.44
58 0.38
59 0.32
60 0.26
61 0.22
62 0.14
63 0.11
64 0.06
65 0.06
66 0.05
67 0.07
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.08
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.06