Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9WQQ5

Protein Details
Accession W9WQQ5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-63PFFGCFGRWRKTREKNKQVRRMRSLGIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 5, mito_nucl 5, plas 4, E.R. 3, golg 3
Family & Domain DBs
Amino Acid Sequences MIAVPMSIGTLFFFSILLLLWRKFHPRTFHKVVDSIPFFGCFGRWRKTREKNKQVRRMRSLGILTGDNDGLSGPVTGGTDTYARHLKKFEDDAARAREKMSFETPTRTPASPYTPGGKSRRSNSITALPKFGSPWKSPKHSTPLTESHDAIPLNPSPMRNGARAYGPFKRTNPEDTDSLQSWEEKWYALGSEHGTPRSIMKATTGVNEIGGHGMQSIDEFEAESGPGQSWRKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.09
5 0.11
6 0.12
7 0.15
8 0.18
9 0.25
10 0.28
11 0.34
12 0.41
13 0.45
14 0.54
15 0.6
16 0.64
17 0.61
18 0.61
19 0.57
20 0.56
21 0.51
22 0.44
23 0.37
24 0.31
25 0.27
26 0.24
27 0.23
28 0.19
29 0.22
30 0.28
31 0.32
32 0.38
33 0.48
34 0.58
35 0.68
36 0.74
37 0.8
38 0.82
39 0.89
40 0.93
41 0.92
42 0.91
43 0.88
44 0.81
45 0.72
46 0.68
47 0.58
48 0.5
49 0.43
50 0.34
51 0.27
52 0.23
53 0.21
54 0.14
55 0.12
56 0.09
57 0.07
58 0.06
59 0.05
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.1
69 0.16
70 0.16
71 0.18
72 0.19
73 0.2
74 0.24
75 0.27
76 0.29
77 0.29
78 0.31
79 0.35
80 0.39
81 0.39
82 0.35
83 0.32
84 0.29
85 0.23
86 0.24
87 0.23
88 0.21
89 0.21
90 0.25
91 0.25
92 0.27
93 0.28
94 0.25
95 0.24
96 0.22
97 0.26
98 0.24
99 0.25
100 0.26
101 0.25
102 0.3
103 0.32
104 0.36
105 0.34
106 0.35
107 0.42
108 0.4
109 0.39
110 0.37
111 0.42
112 0.43
113 0.4
114 0.39
115 0.31
116 0.28
117 0.28
118 0.29
119 0.25
120 0.2
121 0.27
122 0.31
123 0.36
124 0.38
125 0.42
126 0.46
127 0.45
128 0.45
129 0.43
130 0.45
131 0.45
132 0.45
133 0.41
134 0.34
135 0.34
136 0.31
137 0.25
138 0.2
139 0.15
140 0.16
141 0.16
142 0.15
143 0.14
144 0.2
145 0.22
146 0.21
147 0.22
148 0.21
149 0.24
150 0.27
151 0.3
152 0.31
153 0.34
154 0.37
155 0.37
156 0.41
157 0.4
158 0.42
159 0.42
160 0.39
161 0.37
162 0.35
163 0.39
164 0.35
165 0.34
166 0.29
167 0.24
168 0.21
169 0.21
170 0.18
171 0.13
172 0.12
173 0.11
174 0.11
175 0.11
176 0.13
177 0.13
178 0.18
179 0.21
180 0.21
181 0.21
182 0.21
183 0.22
184 0.23
185 0.22
186 0.17
187 0.16
188 0.2
189 0.21
190 0.23
191 0.24
192 0.2
193 0.2
194 0.2
195 0.18
196 0.15
197 0.13
198 0.1
199 0.08
200 0.08
201 0.07
202 0.07
203 0.08
204 0.06
205 0.07
206 0.07
207 0.07
208 0.08
209 0.08
210 0.09
211 0.08
212 0.09
213 0.14
214 0.16