FuNGI

W9VP77

Protein Details

Accession

W9VP77

Localization Confidence

Medium

Confidence Score

11.2

NoLS Segment(s)

Position	Sequence	Protein Nature
495-520	AGWSRSLRYAREKREKAKKGAQAQSE	Hydrophilic

NLS Segment(s)

Position	Sequence
504-516	AREKREKAKKGAQ

Subcellular Location(s)

mito 10.5, nucl 10, cyto_mito 7.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR015222 Tam41
Gene Ontology	GO:0005743 C:mitochondrial inner membrane GO:0004605 F:phosphatidate cytidylyltransferase activity GO:0032049 P:cardiolipin biosynthetic process GO:0016024 P:CDP-diacylglycerol biosynthetic process
Pfam	View protein in Pfam PF09139 Tam41_Mmp37

Amino Acid Sequences

MTLRAVPSVLGKRGLTEVYGFPLVSSIPRFPLSSGIRHYATVEEDRARSDGPPPGFDAAKAKQSPSETPSKSSSPASSSRSSGKKLSSDGSSRPSSTTSGTTDWEENPDLSISKFSELPSRDFGVNQHIIINEEFKEALRQILWKFRAPIRYAFAYGSGVFPQSSGGTGSGGSSKVHPNPPEAVAKVQDGNQKMIDFIFGVSYTQHWHSLNLQDNRDHYSWVGSLGSYAVTKIQDSFGAGVYFNPYITVNGTLIKYGVVNLDTLCRDLSEWDTLYLAGRLQKPVKILRDNPAVRLANQVNLIAAVRTALLLLPPEFTEKELYSTIAGISYMGDPRMTIGGDDPRKVQNIVTHQLPNFRRLYAPLIDNLPNITFNDPACSDRDWLNNPDVNAKLAQNMDPVTRGHMVRRLPNAFRKKLYFEYQSKFRIPRGEFNKMLEETKDEDPDRIRRREGGAFEQRIAQDTEGGGLREEVKQVIEHTVRWPSFMQSLKGPVTAGWSRSLRYAREKREKAKKGAQAQSEADKEKKE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.25
3	0.22
4	0.2
5	0.21
6	0.22
7	0.2
8	0.17
9	0.17
10	0.16
11	0.16
12	0.18
13	0.16
14	0.18
15	0.2
16	0.21
17	0.21
18	0.29
19	0.3
20	0.33
21	0.37
22	0.39
23	0.38
24	0.38
25	0.39
26	0.32
27	0.32
28	0.3
29	0.29
30	0.27
31	0.27
32	0.28
33	0.29
34	0.27
35	0.24
36	0.24
37	0.27
38	0.25
39	0.26
40	0.27
41	0.29
42	0.28
43	0.28
44	0.31
45	0.27
46	0.33
47	0.33
48	0.31
49	0.32
50	0.36
51	0.39
52	0.38
53	0.44
54	0.38
55	0.41
56	0.45
57	0.43
58	0.43
59	0.41
60	0.39
61	0.34
62	0.38
63	0.39
64	0.38
65	0.38
66	0.43
67	0.45
68	0.46
69	0.45
70	0.43
71	0.42
72	0.42
73	0.43
74	0.41
75	0.4
76	0.41
77	0.42
78	0.41
79	0.38
80	0.36
81	0.34
82	0.3
83	0.27
84	0.26
85	0.24
86	0.22
87	0.23
88	0.24
89	0.25
90	0.24
91	0.25
92	0.23
93	0.2
94	0.19
95	0.18
96	0.16
97	0.14
98	0.16
99	0.13
100	0.13
101	0.14
102	0.14
103	0.2
104	0.22
105	0.25
106	0.27
107	0.28
108	0.27
109	0.27
110	0.27
111	0.28
112	0.28
113	0.24
114	0.22
115	0.19
116	0.21
117	0.21
118	0.21
119	0.14
120	0.13
121	0.13
122	0.11
123	0.14
124	0.12
125	0.13
126	0.12
127	0.15
128	0.16
129	0.25
130	0.27
131	0.28
132	0.32
133	0.35
134	0.41
135	0.4
136	0.42
137	0.39
138	0.38
139	0.37
140	0.33
141	0.3
142	0.25
143	0.22
144	0.19
145	0.14
146	0.12
147	0.1
148	0.1
149	0.1
150	0.08
151	0.08
152	0.08
153	0.07
154	0.07
155	0.07
156	0.08
157	0.08
158	0.09
159	0.09
160	0.1
161	0.14
162	0.18
163	0.24
164	0.24
165	0.26
166	0.28
167	0.3
168	0.32
169	0.29
170	0.26
171	0.22
172	0.23
173	0.21
174	0.22
175	0.24
176	0.21
177	0.22
178	0.22
179	0.2
180	0.19
181	0.18
182	0.14
183	0.1
184	0.08
185	0.07
186	0.06
187	0.06
188	0.06
189	0.06
190	0.08
191	0.09
192	0.12
193	0.12
194	0.13
195	0.15
196	0.21
197	0.29
198	0.32
199	0.33
200	0.32
201	0.33
202	0.37
203	0.34
204	0.29
205	0.2
206	0.17
207	0.15
208	0.14
209	0.13
210	0.08
211	0.07
212	0.07
213	0.07
214	0.05
215	0.05
216	0.06
217	0.06
218	0.06
219	0.07
220	0.07
221	0.07
222	0.08
223	0.08
224	0.08
225	0.08
226	0.08
227	0.07
228	0.09
229	0.09
230	0.08
231	0.08
232	0.07
233	0.07
234	0.08
235	0.08
236	0.07
237	0.09
238	0.09
239	0.08
240	0.08
241	0.08
242	0.07
243	0.06
244	0.07
245	0.05
246	0.05
247	0.05
248	0.07
249	0.07
250	0.08
251	0.07
252	0.07
253	0.07
254	0.07
255	0.09
256	0.09
257	0.09
258	0.09
259	0.09
260	0.09
261	0.1
262	0.09
263	0.08
264	0.1
265	0.11
266	0.14
267	0.15
268	0.16
269	0.19
270	0.24
271	0.29
272	0.3
273	0.32
274	0.35
275	0.44
276	0.43
277	0.42
278	0.44
279	0.39
280	0.34
281	0.37
282	0.31
283	0.24
284	0.24
285	0.22
286	0.14
287	0.14
288	0.14
289	0.07
290	0.07
291	0.04
292	0.04
293	0.03
294	0.04
295	0.03
296	0.03
297	0.04
298	0.05
299	0.05
300	0.06
301	0.08
302	0.08
303	0.09
304	0.12
305	0.11
306	0.13
307	0.13
308	0.13
309	0.12
310	0.12
311	0.11
312	0.08
313	0.08
314	0.05
315	0.06
316	0.06
317	0.07
318	0.07
319	0.06
320	0.06
321	0.07
322	0.08
323	0.07
324	0.06
325	0.08
326	0.15
327	0.18
328	0.19
329	0.2
330	0.22
331	0.23
332	0.24
333	0.23
334	0.2
335	0.24
336	0.27
337	0.28
338	0.3
339	0.29
340	0.37
341	0.37
342	0.37
343	0.32
344	0.3
345	0.27
346	0.25
347	0.29
348	0.24
349	0.24
350	0.21
351	0.24
352	0.24
353	0.23
354	0.22
355	0.18
356	0.15
357	0.15
358	0.14
359	0.12
360	0.11
361	0.14
362	0.14
363	0.15
364	0.16
365	0.17
366	0.17
367	0.19
368	0.24
369	0.25
370	0.27
371	0.31
372	0.31
373	0.3
374	0.33
375	0.3
376	0.27
377	0.24
378	0.21
379	0.19
380	0.18
381	0.18
382	0.16
383	0.17
384	0.16
385	0.16
386	0.16
387	0.17
388	0.19
389	0.19
390	0.2
391	0.24
392	0.27
393	0.32
394	0.39
395	0.41
396	0.44
397	0.53
398	0.59
399	0.6
400	0.61
401	0.59
402	0.57
403	0.57
404	0.59
405	0.58
406	0.56
407	0.57
408	0.6
409	0.61
410	0.61
411	0.58
412	0.54
413	0.54
414	0.5
415	0.53
416	0.53
417	0.57
418	0.53
419	0.54
420	0.57
421	0.5
422	0.48
423	0.39
424	0.34
425	0.3
426	0.31
427	0.34
428	0.27
429	0.29
430	0.32
431	0.41
432	0.46
433	0.46
434	0.46
435	0.44
436	0.48
437	0.52
438	0.52
439	0.52
440	0.54
441	0.52
442	0.5
443	0.51
444	0.46
445	0.42
446	0.38
447	0.29
448	0.2
449	0.17
450	0.19
451	0.16
452	0.16
453	0.14
454	0.13
455	0.15
456	0.14
457	0.15
458	0.13
459	0.13
460	0.13
461	0.15
462	0.21
463	0.21
464	0.21
465	0.25
466	0.33
467	0.32
468	0.33
469	0.33
470	0.28
471	0.33
472	0.36
473	0.34
474	0.29
475	0.35
476	0.35
477	0.35
478	0.32
479	0.25
480	0.29
481	0.29
482	0.27
483	0.28
484	0.28
485	0.28
486	0.34
487	0.39
488	0.37
489	0.44
490	0.53
491	0.57
492	0.66
493	0.74
494	0.77
495	0.84
496	0.88
497	0.86
498	0.86
499	0.85
500	0.84
501	0.84
502	0.8
503	0.75
504	0.7
505	0.69
506	0.65
507	0.61

W9VP77

3D AlphaFold-predicted Structure Viewer