Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9VPL1

Protein Details
Accession W9VPL1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
163-184YTSKKISSMKSKAEKKHPEAYAHydrophilic
NLS Segment(s)
PositionSequence
172-189KSKAEKKHPEAYAKASRS
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MATTTYSRHPVSYGSHQKALPVTLPPSGKGPIYTQPISRVADAPDFSDSSTSYSSSGRSGGSFSVRSGSSYAGSHSGTDYESHYSRPGIDVVDELSERMNSAFDPIRMDKSLAKQAQTSGELNAKQRELRELQAMAQRRLGRARVNFAEGVEAAKEARRDVEYTSKKISSMKSKAEKKHPEAYAKASRSRHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.48
4 0.49
5 0.48
6 0.44
7 0.35
8 0.29
9 0.25
10 0.26
11 0.27
12 0.25
13 0.26
14 0.25
15 0.24
16 0.21
17 0.23
18 0.24
19 0.3
20 0.31
21 0.3
22 0.33
23 0.37
24 0.37
25 0.35
26 0.3
27 0.25
28 0.27
29 0.26
30 0.22
31 0.2
32 0.18
33 0.17
34 0.16
35 0.14
36 0.13
37 0.13
38 0.12
39 0.11
40 0.12
41 0.12
42 0.12
43 0.13
44 0.11
45 0.1
46 0.11
47 0.11
48 0.14
49 0.13
50 0.13
51 0.14
52 0.14
53 0.14
54 0.14
55 0.14
56 0.12
57 0.11
58 0.12
59 0.12
60 0.12
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.12
70 0.12
71 0.12
72 0.12
73 0.12
74 0.11
75 0.08
76 0.08
77 0.07
78 0.07
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.04
88 0.07
89 0.08
90 0.08
91 0.12
92 0.13
93 0.15
94 0.16
95 0.17
96 0.17
97 0.19
98 0.27
99 0.25
100 0.25
101 0.23
102 0.24
103 0.26
104 0.26
105 0.23
106 0.17
107 0.19
108 0.2
109 0.22
110 0.24
111 0.22
112 0.21
113 0.2
114 0.23
115 0.22
116 0.22
117 0.23
118 0.21
119 0.24
120 0.28
121 0.32
122 0.28
123 0.31
124 0.3
125 0.28
126 0.31
127 0.3
128 0.31
129 0.3
130 0.36
131 0.33
132 0.35
133 0.34
134 0.31
135 0.3
136 0.23
137 0.21
138 0.14
139 0.12
140 0.09
141 0.11
142 0.11
143 0.1
144 0.12
145 0.13
146 0.14
147 0.17
148 0.28
149 0.32
150 0.36
151 0.41
152 0.39
153 0.39
154 0.42
155 0.45
156 0.45
157 0.47
158 0.52
159 0.57
160 0.65
161 0.72
162 0.79
163 0.82
164 0.78
165 0.8
166 0.77
167 0.75
168 0.7
169 0.7
170 0.7
171 0.64
172 0.66