Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XB08

Protein Details
Accession W9XB08   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-72GDNIIKLPKRRRKARMNEVDEHydrophilic
NLS Segment(s)
PositionSequence
59-65PKRRRKA
Subcellular Location(s) cysk 12, cyto 5.5, cyto_nucl 5.5, mito 5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MGEEEDLGGGFMNLGLFHLAAMPSIPCGSEAKATAIYQTESGGSHEASPAEGDNIIKLPKRRRKARMNEVDEGTQLLTGRERATSDKSLSGDGHRTESPSKPTDIAGRTISEISKGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.07
14 0.08
15 0.1
16 0.11
17 0.12
18 0.14
19 0.16
20 0.16
21 0.16
22 0.16
23 0.15
24 0.13
25 0.12
26 0.11
27 0.09
28 0.1
29 0.1
30 0.09
31 0.08
32 0.09
33 0.08
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.06
42 0.07
43 0.09
44 0.14
45 0.23
46 0.3
47 0.4
48 0.48
49 0.56
50 0.65
51 0.74
52 0.8
53 0.82
54 0.8
55 0.76
56 0.69
57 0.61
58 0.51
59 0.41
60 0.3
61 0.2
62 0.13
63 0.09
64 0.07
65 0.08
66 0.08
67 0.08
68 0.09
69 0.12
70 0.17
71 0.2
72 0.21
73 0.24
74 0.24
75 0.26
76 0.26
77 0.26
78 0.26
79 0.24
80 0.26
81 0.23
82 0.25
83 0.27
84 0.3
85 0.33
86 0.31
87 0.32
88 0.29
89 0.3
90 0.34
91 0.33
92 0.33
93 0.29
94 0.28
95 0.28
96 0.29
97 0.27
98 0.25