Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9X981

Protein Details
Accession W9X981    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
431-473RDEPPEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKRYEGBasic
NLS Segment(s)
PositionSequence
433-470EPPEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKR
Subcellular Location(s) mito 16, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
PROSITE View protein in PROSITE  
PS50031  EH  
CDD cd00052  EH  
Amino Acid Sequences MSEKQARRPPVAPKPSFIQQHNATAPRISPLPSPALQGATLAFGPAAVKTPNISVSASHNPSAGALLAATTASIRKQQQQQNEAPSQEATVNPRGRTLTTEKLPVAVSVYSSLSPPKPGLRPRPPRSTSAVAAIAASAKTSPVRRPELKRDQASSYLARRDPSQVRSRGMSTSSSSEAVQSLQQSAAALAGAKASMTTAPVQVQTATGDKHRSDLGYLSNLPLSSAQTSSAPSPSLSGAAAAATASRNAASLEARRRALSTSEESSPSAPVFRNLTVSPQSTTSSLWPRVKVTPPPTDSESDTGRSKVEDAHKPLPAPVPLRANRAAIVAQEQASALDSRTGMTASSLADAMVAGSIAASHTGSRGASPASSKVPPPIPRRRSKSVGAFESARQLMHLPAMRSETISQTPKLKPLPVRPMRQTLRNPSPERDEPPEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKRYEGVWAANRGLLLDYDLGNPGLGPRKDGTPVTDLVVNVVARDIWERSRLPKDVLEEIWDLVAQPGAKALNREEFVVGLWLIDQRLKGRKLPIKVSPSVWSSVRHPEGVKFSNKALRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.67
4 0.59
5 0.58
6 0.51
7 0.57
8 0.6
9 0.57
10 0.5
11 0.45
12 0.42
13 0.37
14 0.34
15 0.27
16 0.23
17 0.24
18 0.28
19 0.27
20 0.3
21 0.28
22 0.28
23 0.26
24 0.24
25 0.2
26 0.16
27 0.15
28 0.12
29 0.09
30 0.08
31 0.08
32 0.08
33 0.1
34 0.09
35 0.09
36 0.1
37 0.13
38 0.15
39 0.16
40 0.16
41 0.15
42 0.21
43 0.3
44 0.32
45 0.31
46 0.29
47 0.27
48 0.27
49 0.26
50 0.2
51 0.11
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.07
60 0.13
61 0.16
62 0.24
63 0.34
64 0.4
65 0.49
66 0.57
67 0.62
68 0.65
69 0.68
70 0.61
71 0.53
72 0.47
73 0.39
74 0.32
75 0.28
76 0.24
77 0.27
78 0.31
79 0.3
80 0.32
81 0.33
82 0.32
83 0.35
84 0.36
85 0.36
86 0.35
87 0.4
88 0.37
89 0.38
90 0.37
91 0.32
92 0.27
93 0.19
94 0.16
95 0.13
96 0.14
97 0.12
98 0.13
99 0.16
100 0.14
101 0.16
102 0.18
103 0.21
104 0.27
105 0.36
106 0.46
107 0.53
108 0.64
109 0.69
110 0.78
111 0.75
112 0.72
113 0.71
114 0.66
115 0.57
116 0.51
117 0.45
118 0.35
119 0.31
120 0.27
121 0.21
122 0.14
123 0.13
124 0.07
125 0.07
126 0.1
127 0.12
128 0.17
129 0.23
130 0.31
131 0.39
132 0.47
133 0.57
134 0.65
135 0.71
136 0.72
137 0.69
138 0.65
139 0.61
140 0.57
141 0.52
142 0.46
143 0.43
144 0.39
145 0.36
146 0.34
147 0.37
148 0.39
149 0.41
150 0.45
151 0.43
152 0.44
153 0.46
154 0.46
155 0.41
156 0.37
157 0.32
158 0.26
159 0.24
160 0.23
161 0.22
162 0.2
163 0.18
164 0.17
165 0.15
166 0.14
167 0.12
168 0.11
169 0.1
170 0.1
171 0.09
172 0.09
173 0.08
174 0.06
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.04
182 0.04
183 0.05
184 0.06
185 0.07
186 0.08
187 0.09
188 0.1
189 0.09
190 0.1
191 0.1
192 0.11
193 0.11
194 0.12
195 0.15
196 0.15
197 0.16
198 0.17
199 0.15
200 0.15
201 0.15
202 0.15
203 0.16
204 0.16
205 0.15
206 0.15
207 0.15
208 0.14
209 0.13
210 0.12
211 0.09
212 0.09
213 0.09
214 0.09
215 0.1
216 0.11
217 0.11
218 0.11
219 0.09
220 0.1
221 0.1
222 0.1
223 0.08
224 0.07
225 0.06
226 0.06
227 0.05
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.06
237 0.07
238 0.12
239 0.18
240 0.22
241 0.22
242 0.23
243 0.23
244 0.23
245 0.24
246 0.22
247 0.2
248 0.2
249 0.21
250 0.21
251 0.21
252 0.21
253 0.2
254 0.16
255 0.14
256 0.11
257 0.11
258 0.12
259 0.12
260 0.14
261 0.13
262 0.16
263 0.17
264 0.18
265 0.17
266 0.16
267 0.17
268 0.15
269 0.16
270 0.16
271 0.19
272 0.24
273 0.25
274 0.25
275 0.27
276 0.3
277 0.32
278 0.35
279 0.35
280 0.36
281 0.36
282 0.38
283 0.38
284 0.36
285 0.34
286 0.3
287 0.26
288 0.22
289 0.21
290 0.18
291 0.16
292 0.14
293 0.13
294 0.16
295 0.21
296 0.24
297 0.29
298 0.33
299 0.34
300 0.34
301 0.35
302 0.33
303 0.29
304 0.25
305 0.22
306 0.26
307 0.27
308 0.31
309 0.31
310 0.29
311 0.26
312 0.26
313 0.23
314 0.15
315 0.15
316 0.12
317 0.11
318 0.1
319 0.09
320 0.08
321 0.09
322 0.09
323 0.06
324 0.06
325 0.06
326 0.06
327 0.07
328 0.07
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.06
335 0.05
336 0.05
337 0.05
338 0.05
339 0.04
340 0.03
341 0.02
342 0.02
343 0.02
344 0.02
345 0.03
346 0.03
347 0.03
348 0.04
349 0.05
350 0.05
351 0.05
352 0.06
353 0.06
354 0.07
355 0.08
356 0.11
357 0.13
358 0.15
359 0.15
360 0.18
361 0.24
362 0.32
363 0.39
364 0.48
365 0.53
366 0.61
367 0.69
368 0.72
369 0.71
370 0.69
371 0.7
372 0.67
373 0.62
374 0.56
375 0.5
376 0.43
377 0.44
378 0.37
379 0.27
380 0.2
381 0.17
382 0.14
383 0.17
384 0.19
385 0.14
386 0.15
387 0.18
388 0.18
389 0.18
390 0.19
391 0.18
392 0.21
393 0.23
394 0.23
395 0.27
396 0.28
397 0.33
398 0.34
399 0.36
400 0.37
401 0.43
402 0.53
403 0.54
404 0.6
405 0.6
406 0.67
407 0.65
408 0.68
409 0.66
410 0.65
411 0.66
412 0.68
413 0.67
414 0.61
415 0.65
416 0.61
417 0.59
418 0.56
419 0.53
420 0.49
421 0.51
422 0.57
423 0.54
424 0.55
425 0.58
426 0.61
427 0.66
428 0.71
429 0.76
430 0.78
431 0.84
432 0.89
433 0.92
434 0.93
435 0.92
436 0.91
437 0.88
438 0.85
439 0.82
440 0.78
441 0.78
442 0.77
443 0.72
444 0.67
445 0.64
446 0.6
447 0.63
448 0.65
449 0.66
450 0.67
451 0.73
452 0.75
453 0.82
454 0.81
455 0.76
456 0.7
457 0.61
458 0.57
459 0.55
460 0.55
461 0.51
462 0.51
463 0.46
464 0.44
465 0.4
466 0.34
467 0.25
468 0.18
469 0.12
470 0.1
471 0.1
472 0.1
473 0.11
474 0.11
475 0.1
476 0.1
477 0.11
478 0.18
479 0.17
480 0.19
481 0.2
482 0.22
483 0.26
484 0.27
485 0.28
486 0.24
487 0.25
488 0.24
489 0.25
490 0.22
491 0.2
492 0.23
493 0.19
494 0.15
495 0.14
496 0.12
497 0.1
498 0.12
499 0.13
500 0.12
501 0.17
502 0.2
503 0.26
504 0.33
505 0.35
506 0.37
507 0.38
508 0.41
509 0.41
510 0.4
511 0.38
512 0.32
513 0.3
514 0.27
515 0.22
516 0.18
517 0.13
518 0.14
519 0.09
520 0.08
521 0.1
522 0.12
523 0.13
524 0.15
525 0.18
526 0.24
527 0.25
528 0.27
529 0.25
530 0.23
531 0.22
532 0.23
533 0.19
534 0.11
535 0.11
536 0.11
537 0.11
538 0.13
539 0.14
540 0.17
541 0.26
542 0.29
543 0.33
544 0.42
545 0.49
546 0.55
547 0.61
548 0.64
549 0.64
550 0.65
551 0.64
552 0.59
553 0.55
554 0.52
555 0.46
556 0.41
557 0.37
558 0.43
559 0.43
560 0.41
561 0.39
562 0.41
563 0.47
564 0.5
565 0.52
566 0.44
567 0.47