Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K471

Protein Details
Accession J3K471    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-89SSHGPKQPSKVRKPQRKTTTTKSRGHydrophilic
NLS Segment(s)
PositionSequence
54-58KGKSK
66-81SHGPKQPSKVRKPQRK
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
KEGG cim:CIMG_07818  -  
Amino Acid Sequences MALNSESSSKGKGTLVECRSSTQAASSTDSGGKGTAVESRSLTETASSTNHKGKGKSKTPNSTSSSHGPKQPSKVRKPQRKTTTTKSRGAIVPAKNWPRCWDCQEPLSEIPPCTCQECEMPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.36
4 0.36
5 0.37
6 0.37
7 0.34
8 0.3
9 0.23
10 0.23
11 0.21
12 0.24
13 0.22
14 0.21
15 0.22
16 0.22
17 0.19
18 0.15
19 0.13
20 0.09
21 0.09
22 0.11
23 0.1
24 0.11
25 0.12
26 0.13
27 0.14
28 0.14
29 0.14
30 0.11
31 0.1
32 0.1
33 0.13
34 0.14
35 0.15
36 0.19
37 0.24
38 0.26
39 0.29
40 0.35
41 0.41
42 0.47
43 0.53
44 0.56
45 0.6
46 0.61
47 0.65
48 0.62
49 0.55
50 0.51
51 0.48
52 0.47
53 0.4
54 0.41
55 0.38
56 0.38
57 0.44
58 0.48
59 0.52
60 0.53
61 0.61
62 0.68
63 0.74
64 0.79
65 0.81
66 0.83
67 0.82
68 0.82
69 0.82
70 0.83
71 0.79
72 0.77
73 0.68
74 0.63
75 0.56
76 0.54
77 0.5
78 0.42
79 0.41
80 0.43
81 0.51
82 0.49
83 0.48
84 0.49
85 0.47
86 0.49
87 0.51
88 0.51
89 0.46
90 0.49
91 0.5
92 0.49
93 0.47
94 0.46
95 0.42
96 0.34
97 0.32
98 0.3
99 0.29
100 0.27
101 0.25
102 0.22