Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3KKT4

Protein Details
Accession J3KKT4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-68RSKLAKATNRGKGRRKSAKERAQSLCHydrophilic
81-101ILGRQTRRSAKKNKNAAKQMQHydrophilic
NLS Segment(s)
PositionSequence
45-63KLAKATNRGKGRRKSAKER
88-95RSAKKNKN
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 5
Family & Domain DBs
KEGG cim:CIMG_12713  -  
Amino Acid Sequences MVEDKITTKQLAAIEHLEELHYDEVAGLQATLSDHAKELSNIRSKLAKATNRGKGRRKSAKERAQSLCATKGNDLRLMSFILGRQTRRSAKKNKNAAKQMQGFKHKMNAKNKFLMDNIVRGREEAGLALIQRDLEHTQHRQSEADQSLVSTPHTARDNNIMHALTTSEPSTSKADGPGEGRQAAQNMRRVATAAQIINRGKGAMTFGMKISTLESQNQVLLAANEVMVHQHRKEKENLRAMNHHVITEIGKYKQRVECLAELIGISDLGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.18
5 0.16
6 0.16
7 0.13
8 0.1
9 0.09
10 0.08
11 0.08
12 0.09
13 0.08
14 0.05
15 0.05
16 0.06
17 0.06
18 0.08
19 0.09
20 0.09
21 0.1
22 0.11
23 0.12
24 0.13
25 0.16
26 0.22
27 0.29
28 0.29
29 0.31
30 0.35
31 0.34
32 0.41
33 0.46
34 0.44
35 0.44
36 0.53
37 0.6
38 0.65
39 0.73
40 0.75
41 0.75
42 0.8
43 0.82
44 0.81
45 0.82
46 0.84
47 0.85
48 0.84
49 0.84
50 0.78
51 0.73
52 0.68
53 0.6
54 0.56
55 0.49
56 0.42
57 0.37
58 0.36
59 0.33
60 0.33
61 0.3
62 0.24
63 0.23
64 0.22
65 0.19
66 0.15
67 0.14
68 0.16
69 0.19
70 0.19
71 0.21
72 0.27
73 0.34
74 0.42
75 0.49
76 0.54
77 0.61
78 0.7
79 0.78
80 0.8
81 0.82
82 0.83
83 0.79
84 0.78
85 0.75
86 0.72
87 0.68
88 0.67
89 0.6
90 0.52
91 0.54
92 0.52
93 0.52
94 0.55
95 0.57
96 0.54
97 0.57
98 0.57
99 0.51
100 0.45
101 0.43
102 0.34
103 0.31
104 0.28
105 0.25
106 0.24
107 0.21
108 0.22
109 0.17
110 0.16
111 0.09
112 0.08
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.06
120 0.07
121 0.08
122 0.11
123 0.13
124 0.16
125 0.18
126 0.19
127 0.18
128 0.18
129 0.24
130 0.22
131 0.21
132 0.17
133 0.16
134 0.16
135 0.16
136 0.15
137 0.09
138 0.08
139 0.11
140 0.13
141 0.13
142 0.13
143 0.21
144 0.23
145 0.22
146 0.25
147 0.21
148 0.19
149 0.19
150 0.19
151 0.11
152 0.11
153 0.1
154 0.08
155 0.08
156 0.11
157 0.13
158 0.13
159 0.13
160 0.14
161 0.15
162 0.16
163 0.19
164 0.19
165 0.2
166 0.19
167 0.19
168 0.17
169 0.19
170 0.21
171 0.22
172 0.25
173 0.24
174 0.24
175 0.24
176 0.24
177 0.22
178 0.22
179 0.22
180 0.18
181 0.18
182 0.23
183 0.24
184 0.24
185 0.23
186 0.2
187 0.15
188 0.14
189 0.15
190 0.12
191 0.13
192 0.13
193 0.13
194 0.14
195 0.15
196 0.14
197 0.14
198 0.15
199 0.15
200 0.16
201 0.18
202 0.18
203 0.18
204 0.18
205 0.16
206 0.13
207 0.11
208 0.1
209 0.09
210 0.08
211 0.07
212 0.07
213 0.09
214 0.11
215 0.15
216 0.15
217 0.23
218 0.27
219 0.31
220 0.41
221 0.48
222 0.55
223 0.61
224 0.65
225 0.64
226 0.66
227 0.68
228 0.68
229 0.59
230 0.5
231 0.4
232 0.36
233 0.31
234 0.3
235 0.29
236 0.23
237 0.28
238 0.29
239 0.36
240 0.4
241 0.42
242 0.42
243 0.43
244 0.43
245 0.41
246 0.4
247 0.33
248 0.28
249 0.25
250 0.21