Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9VE57

Protein Details
Accession W9VE57    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
209-244GKTFRGEGRRERKERIKRQERRQRNNERTSRKAGKMBasic
NLS Segment(s)
PositionSequence
121-146WKPLPKPKAPTKWELFARKKGIGKYG
198-245KKEKAGAESGDGKTFRGEGRRERKERIKRQERRQRNNERTSRKAGKMG
Subcellular Location(s) nucl 11, mito 10.5, cyto_mito 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MATDTMMDTVMVEAGTQVSILASTISHHAPAKSEKLPTTVEKPTPYTYDLGYLTATDPNPLPATSQLLSQSLSDRNEALRQVARDGAQSLLNTLLTTCPIQSTTDGLVMTPPAPQHYLPRWKPLPKPKAPTKWELFARKKGIGKYGGNLKGGAAQEERRKNLVYDEESGEWVKKWGYKGRNKKDEGEWLVELDDKAVKKEKAGAESGDGKTFRGEGRRERKERIKRQERRQRNNERTSRKAGKMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.05
9 0.04
10 0.05
11 0.09
12 0.09
13 0.12
14 0.14
15 0.14
16 0.18
17 0.23
18 0.28
19 0.29
20 0.33
21 0.32
22 0.34
23 0.37
24 0.37
25 0.39
26 0.4
27 0.4
28 0.39
29 0.41
30 0.41
31 0.4
32 0.38
33 0.33
34 0.26
35 0.26
36 0.23
37 0.2
38 0.17
39 0.15
40 0.14
41 0.16
42 0.15
43 0.13
44 0.12
45 0.13
46 0.14
47 0.14
48 0.14
49 0.12
50 0.16
51 0.15
52 0.17
53 0.16
54 0.16
55 0.17
56 0.16
57 0.18
58 0.17
59 0.18
60 0.17
61 0.16
62 0.17
63 0.18
64 0.18
65 0.18
66 0.17
67 0.17
68 0.17
69 0.19
70 0.18
71 0.16
72 0.17
73 0.15
74 0.13
75 0.12
76 0.12
77 0.1
78 0.1
79 0.09
80 0.08
81 0.07
82 0.06
83 0.07
84 0.06
85 0.06
86 0.07
87 0.08
88 0.08
89 0.1
90 0.1
91 0.11
92 0.11
93 0.1
94 0.1
95 0.1
96 0.09
97 0.08
98 0.07
99 0.06
100 0.08
101 0.09
102 0.13
103 0.19
104 0.29
105 0.29
106 0.37
107 0.4
108 0.44
109 0.51
110 0.57
111 0.6
112 0.57
113 0.64
114 0.66
115 0.71
116 0.69
117 0.69
118 0.63
119 0.59
120 0.59
121 0.61
122 0.57
123 0.54
124 0.54
125 0.52
126 0.52
127 0.47
128 0.45
129 0.41
130 0.37
131 0.34
132 0.38
133 0.37
134 0.34
135 0.33
136 0.28
137 0.26
138 0.25
139 0.23
140 0.16
141 0.17
142 0.24
143 0.29
144 0.31
145 0.28
146 0.29
147 0.28
148 0.3
149 0.32
150 0.27
151 0.26
152 0.27
153 0.26
154 0.26
155 0.27
156 0.23
157 0.17
158 0.15
159 0.13
160 0.13
161 0.16
162 0.23
163 0.32
164 0.41
165 0.53
166 0.63
167 0.71
168 0.72
169 0.73
170 0.7
171 0.71
172 0.65
173 0.59
174 0.49
175 0.4
176 0.37
177 0.33
178 0.27
179 0.18
180 0.17
181 0.12
182 0.14
183 0.2
184 0.2
185 0.19
186 0.27
187 0.3
188 0.31
189 0.33
190 0.32
191 0.3
192 0.37
193 0.37
194 0.35
195 0.31
196 0.28
197 0.26
198 0.26
199 0.24
200 0.24
201 0.28
202 0.33
203 0.44
204 0.54
205 0.59
206 0.66
207 0.74
208 0.78
209 0.84
210 0.85
211 0.85
212 0.85
213 0.91
214 0.93
215 0.94
216 0.94
217 0.94
218 0.94
219 0.94
220 0.94
221 0.93
222 0.91
223 0.88
224 0.87
225 0.85