Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KDD5

Protein Details
Accession J3KDD5    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
198-220LTHSLKKAPGSKKRKKNGSDPTVHydrophilic
269-291VLEEENERKKRRKQMGNSEALQSHydrophilic
NLS Segment(s)
PositionSequence
201-214SLKKAPGSKKRKKN
277-280KKRR
Subcellular Location(s) nucl 24.5, cyto_nucl 14.333, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG cim:CIMG_04389  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPTRRELVKEAAKAPSASQLKEAQREQLEHFWTTCPLSHKELLPPIVSDSVGNLYNKDTILRFLLPGDDVEGISSKADCEEILCGRVKGLRDIVEVKFEVDDVAVDAEGKKKKRFICPVTNKELGPSVRSVYLVPCGHAFAEEAIREMKSDKCLQCTESYQEENVIPILPTKEAEKERLKSRMQKLAGEGLTHSLKKAPGSKKRKKNGSDPTVAKGEAVIDGTKTKVSSAPGSGPISKTSTPIPSTGSGIKNAATAMLTNRVLEEENERKKRRKQMGNSEALQSLFTSSSKNQQSKDGDFMTRGFTIPSGARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.42
4 0.43
5 0.45
6 0.46
7 0.44
8 0.4
9 0.41
10 0.36
11 0.31
12 0.32
13 0.35
14 0.38
15 0.45
16 0.45
17 0.43
18 0.44
19 0.46
20 0.47
21 0.46
22 0.44
23 0.38
24 0.38
25 0.32
26 0.3
27 0.28
28 0.27
29 0.25
30 0.25
31 0.29
32 0.32
33 0.33
34 0.37
35 0.41
36 0.4
37 0.36
38 0.33
39 0.3
40 0.28
41 0.25
42 0.19
43 0.15
44 0.15
45 0.16
46 0.16
47 0.14
48 0.14
49 0.16
50 0.16
51 0.16
52 0.14
53 0.13
54 0.16
55 0.16
56 0.15
57 0.14
58 0.15
59 0.14
60 0.13
61 0.13
62 0.1
63 0.09
64 0.09
65 0.1
66 0.09
67 0.08
68 0.08
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.09
75 0.09
76 0.12
77 0.13
78 0.13
79 0.13
80 0.16
81 0.16
82 0.16
83 0.18
84 0.18
85 0.19
86 0.23
87 0.23
88 0.24
89 0.23
90 0.21
91 0.17
92 0.15
93 0.13
94 0.09
95 0.08
96 0.05
97 0.05
98 0.04
99 0.04
100 0.05
101 0.1
102 0.15
103 0.19
104 0.21
105 0.26
106 0.31
107 0.4
108 0.5
109 0.52
110 0.59
111 0.66
112 0.71
113 0.73
114 0.7
115 0.61
116 0.52
117 0.49
118 0.38
119 0.29
120 0.23
121 0.17
122 0.15
123 0.16
124 0.15
125 0.11
126 0.17
127 0.15
128 0.15
129 0.14
130 0.14
131 0.13
132 0.13
133 0.12
134 0.06
135 0.08
136 0.07
137 0.08
138 0.08
139 0.08
140 0.08
141 0.09
142 0.1
143 0.11
144 0.18
145 0.18
146 0.21
147 0.22
148 0.23
149 0.24
150 0.26
151 0.26
152 0.23
153 0.23
154 0.19
155 0.2
156 0.18
157 0.16
158 0.14
159 0.11
160 0.07
161 0.07
162 0.08
163 0.07
164 0.07
165 0.08
166 0.13
167 0.14
168 0.2
169 0.25
170 0.28
171 0.33
172 0.4
173 0.42
174 0.46
175 0.5
176 0.53
177 0.49
178 0.47
179 0.44
180 0.44
181 0.41
182 0.33
183 0.27
184 0.22
185 0.22
186 0.2
187 0.18
188 0.13
189 0.13
190 0.16
191 0.24
192 0.3
193 0.38
194 0.49
195 0.59
196 0.67
197 0.76
198 0.83
199 0.8
200 0.81
201 0.82
202 0.79
203 0.78
204 0.71
205 0.65
206 0.58
207 0.53
208 0.42
209 0.31
210 0.23
211 0.15
212 0.13
213 0.09
214 0.07
215 0.08
216 0.09
217 0.1
218 0.09
219 0.09
220 0.1
221 0.13
222 0.15
223 0.17
224 0.19
225 0.23
226 0.26
227 0.28
228 0.26
229 0.26
230 0.28
231 0.25
232 0.24
233 0.22
234 0.24
235 0.23
236 0.23
237 0.25
238 0.22
239 0.25
240 0.29
241 0.28
242 0.25
243 0.24
244 0.23
245 0.21
246 0.19
247 0.16
248 0.11
249 0.1
250 0.1
251 0.15
252 0.15
253 0.15
254 0.15
255 0.16
256 0.16
257 0.17
258 0.22
259 0.26
260 0.36
261 0.46
262 0.52
263 0.58
264 0.66
265 0.75
266 0.78
267 0.79
268 0.79
269 0.81
270 0.86
271 0.87
272 0.81
273 0.74
274 0.65
275 0.55
276 0.44
277 0.33
278 0.24
279 0.17
280 0.15
281 0.15
282 0.15
283 0.24
284 0.32
285 0.37
286 0.37
287 0.44
288 0.51
289 0.51
290 0.57
291 0.52
292 0.46
293 0.43
294 0.42
295 0.38
296 0.32
297 0.28
298 0.22
299 0.17
300 0.19