Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VZY3

Protein Details
Accession W9VZY3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-91ETEPMTFKEKKKRRNRHRKIVRSKHKYTLCRBasic
NLS Segment(s)
PositionSequence
68-85KEKKKRRNRHRKIVRSKH
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MKNVSPGDILRFNRASILGSRDYTLKAGSASTESYDKRRTGEPNYLDERLFECRVRVMGIETEPMTFKEKKKRRNRHRKIVRSKHKYTLCRVMQVRAKGLDELIQGEKGMVLLEGQEKGNADASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.22
4 0.26
5 0.22
6 0.22
7 0.23
8 0.22
9 0.23
10 0.22
11 0.19
12 0.14
13 0.11
14 0.1
15 0.11
16 0.11
17 0.1
18 0.11
19 0.15
20 0.16
21 0.2
22 0.24
23 0.24
24 0.25
25 0.29
26 0.31
27 0.33
28 0.4
29 0.39
30 0.41
31 0.45
32 0.44
33 0.39
34 0.35
35 0.32
36 0.27
37 0.26
38 0.19
39 0.15
40 0.14
41 0.15
42 0.14
43 0.13
44 0.1
45 0.09
46 0.1
47 0.11
48 0.1
49 0.1
50 0.1
51 0.11
52 0.13
53 0.15
54 0.18
55 0.28
56 0.34
57 0.44
58 0.55
59 0.65
60 0.73
61 0.82
62 0.88
63 0.89
64 0.94
65 0.94
66 0.95
67 0.95
68 0.94
69 0.92
70 0.87
71 0.85
72 0.82
73 0.76
74 0.72
75 0.71
76 0.62
77 0.61
78 0.57
79 0.55
80 0.53
81 0.51
82 0.48
83 0.4
84 0.39
85 0.31
86 0.3
87 0.26
88 0.2
89 0.2
90 0.18
91 0.16
92 0.14
93 0.14
94 0.13
95 0.1
96 0.09
97 0.06
98 0.04
99 0.06
100 0.08
101 0.1
102 0.11
103 0.12
104 0.13
105 0.14