Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9X7R4

Protein Details
Accession W9X7R4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-48LLNKYRPETKVQKKERLHQEATHydrophilic
NLS Segment(s)
PositionSequence
182-184KKR
Subcellular Location(s) cyto 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR001921  Ribosomal_L7A/L8  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MRLKVPPAIAQFQNTLDRNTAAQCFKLLNKYRPETKVQKKERLHQEATAVQEGKKKEDVSKKPYTVKYGLNHVVGLIEAKKASLVLIPNDVDPIELVVFLPALCRKMGIPYAIIKGKARLGTVVHKKTAAVLALSEVKGEDKSELSKLVNTINEGYTSKYEENRRHWGGGIMGVKAVARMEKKRKAIESAIKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.29
4 0.28
5 0.27
6 0.28
7 0.3
8 0.23
9 0.23
10 0.22
11 0.23
12 0.24
13 0.33
14 0.38
15 0.4
16 0.47
17 0.52
18 0.59
19 0.6
20 0.66
21 0.66
22 0.69
23 0.73
24 0.73
25 0.77
26 0.75
27 0.81
28 0.83
29 0.81
30 0.73
31 0.65
32 0.61
33 0.55
34 0.52
35 0.48
36 0.38
37 0.3
38 0.32
39 0.3
40 0.28
41 0.29
42 0.26
43 0.28
44 0.38
45 0.44
46 0.48
47 0.56
48 0.57
49 0.61
50 0.63
51 0.61
52 0.55
53 0.53
54 0.47
55 0.46
56 0.45
57 0.37
58 0.34
59 0.29
60 0.25
61 0.18
62 0.17
63 0.09
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.1
74 0.1
75 0.1
76 0.11
77 0.11
78 0.08
79 0.07
80 0.07
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.05
88 0.05
89 0.06
90 0.05
91 0.06
92 0.06
93 0.09
94 0.1
95 0.1
96 0.11
97 0.12
98 0.17
99 0.18
100 0.19
101 0.17
102 0.17
103 0.19
104 0.19
105 0.17
106 0.15
107 0.15
108 0.23
109 0.32
110 0.34
111 0.32
112 0.31
113 0.31
114 0.3
115 0.3
116 0.22
117 0.13
118 0.1
119 0.11
120 0.13
121 0.13
122 0.12
123 0.1
124 0.1
125 0.1
126 0.11
127 0.1
128 0.08
129 0.1
130 0.12
131 0.14
132 0.14
133 0.15
134 0.16
135 0.18
136 0.18
137 0.18
138 0.19
139 0.18
140 0.19
141 0.18
142 0.19
143 0.17
144 0.2
145 0.21
146 0.25
147 0.32
148 0.38
149 0.44
150 0.51
151 0.53
152 0.51
153 0.49
154 0.46
155 0.39
156 0.39
157 0.34
158 0.25
159 0.21
160 0.2
161 0.19
162 0.16
163 0.16
164 0.13
165 0.17
166 0.26
167 0.35
168 0.44
169 0.51
170 0.59
171 0.62
172 0.64
173 0.68