Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VSA7

Protein Details
Accession W9VSA7   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-30EKGSYSTKRLRDQKLWRRLRWCCYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 8, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007219  Transcription_factor_dom_fun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04082  Fungal_trans  
CDD cd12148  fungal_TF_MHR  
Amino Acid Sequences MSLGLNEKGSYSTKRLRDQKLWRRLRWCCYVRDRMIAIGTRKPMHFADDQVRIPALSLDDFDLETPSTAMTRIQDAFTMIDYDCRVALAKMFMAKVKLLSTVGRVLEKLYLLRSIRGPNTGPRMFYNPKVSNFDLEGFLKRANELDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.56
3 0.62
4 0.68
5 0.75
6 0.79
7 0.82
8 0.85
9 0.82
10 0.82
11 0.82
12 0.79
13 0.78
14 0.72
15 0.69
16 0.68
17 0.71
18 0.65
19 0.63
20 0.57
21 0.48
22 0.48
23 0.44
24 0.38
25 0.33
26 0.33
27 0.3
28 0.29
29 0.3
30 0.27
31 0.26
32 0.25
33 0.24
34 0.26
35 0.29
36 0.3
37 0.27
38 0.27
39 0.22
40 0.21
41 0.18
42 0.13
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.09
66 0.07
67 0.08
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.06
74 0.07
75 0.06
76 0.07
77 0.08
78 0.09
79 0.09
80 0.1
81 0.1
82 0.11
83 0.11
84 0.11
85 0.1
86 0.11
87 0.12
88 0.14
89 0.15
90 0.15
91 0.15
92 0.14
93 0.14
94 0.15
95 0.14
96 0.11
97 0.16
98 0.16
99 0.18
100 0.2
101 0.24
102 0.25
103 0.28
104 0.29
105 0.3
106 0.38
107 0.38
108 0.37
109 0.35
110 0.41
111 0.42
112 0.46
113 0.49
114 0.46
115 0.49
116 0.54
117 0.52
118 0.48
119 0.46
120 0.42
121 0.36
122 0.32
123 0.31
124 0.26
125 0.27
126 0.23
127 0.22