Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9VPV9

Protein Details
Accession W9VPV9    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26METARRQKKIANRLKKLRLRVKDPTIHydrophilic
NLS Segment(s)
PositionSequence
5-20RRQKKIANRLKKLRLR
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences METARRQKKIANRLKKLRLRVKDPTIPTKIYKAGTIKNQEHNLTKLPQEVRAMIFKALPLNADRASLALTCKTQAASYEQLKEEKNKKDYDHPVPKRSLRTHRLQMLVRLRDTMPPSYRLCYTCLQFIDTAQRDNKGTWGGDPMKVQGLKADKAAMVEGPRCPLCIAAEKLETAKHKETYKKYLALADSCSLKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.87
5 0.85
6 0.82
7 0.81
8 0.8
9 0.78
10 0.77
11 0.75
12 0.71
13 0.65
14 0.6
15 0.55
16 0.51
17 0.44
18 0.43
19 0.39
20 0.39
21 0.44
22 0.5
23 0.51
24 0.54
25 0.58
26 0.56
27 0.54
28 0.51
29 0.47
30 0.41
31 0.36
32 0.35
33 0.31
34 0.31
35 0.29
36 0.28
37 0.26
38 0.27
39 0.27
40 0.21
41 0.2
42 0.17
43 0.17
44 0.15
45 0.14
46 0.11
47 0.13
48 0.13
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.11
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.09
61 0.1
62 0.13
63 0.17
64 0.19
65 0.22
66 0.23
67 0.26
68 0.27
69 0.32
70 0.36
71 0.37
72 0.39
73 0.38
74 0.39
75 0.45
76 0.51
77 0.55
78 0.58
79 0.57
80 0.58
81 0.59
82 0.61
83 0.59
84 0.58
85 0.57
86 0.51
87 0.53
88 0.54
89 0.54
90 0.56
91 0.5
92 0.51
93 0.5
94 0.48
95 0.41
96 0.36
97 0.31
98 0.3
99 0.31
100 0.29
101 0.23
102 0.24
103 0.25
104 0.26
105 0.28
106 0.25
107 0.26
108 0.24
109 0.23
110 0.24
111 0.23
112 0.22
113 0.2
114 0.2
115 0.25
116 0.23
117 0.26
118 0.23
119 0.24
120 0.24
121 0.24
122 0.25
123 0.19
124 0.18
125 0.15
126 0.21
127 0.21
128 0.23
129 0.23
130 0.22
131 0.25
132 0.25
133 0.24
134 0.21
135 0.23
136 0.22
137 0.22
138 0.23
139 0.17
140 0.18
141 0.19
142 0.16
143 0.15
144 0.16
145 0.16
146 0.19
147 0.19
148 0.19
149 0.18
150 0.17
151 0.17
152 0.23
153 0.25
154 0.25
155 0.26
156 0.26
157 0.27
158 0.31
159 0.32
160 0.31
161 0.33
162 0.34
163 0.39
164 0.47
165 0.53
166 0.58
167 0.62
168 0.6
169 0.57
170 0.58
171 0.56
172 0.5
173 0.47
174 0.42