Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XWU3

Protein Details
Accession W9XWU3   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-28VSAKKHVPIIKKHRKAWHRHQSDTFKCHydrophilic
30-49PSAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
11-17IKKHRKA
37-37K
44-45RR
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIIKKHRKAWHRHQSDTFKCVPSAWRKPKGIDNRVRRRFKGQMVMPSIGFGSNKKTRHMMPSGHKAFLVHNARDVELLLMHNRTYAAEIASAVSSRKRIEIVAKAKALSVKVTNPNVKIRKES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.85
4 0.86
5 0.86
6 0.82
7 0.81
8 0.82
9 0.83
10 0.79
11 0.75
12 0.69
13 0.59
14 0.51
15 0.45
16 0.43
17 0.42
18 0.47
19 0.51
20 0.55
21 0.55
22 0.58
23 0.66
24 0.69
25 0.7
26 0.68
27 0.7
28 0.72
29 0.8
30 0.83
31 0.76
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.34
63 0.33
64 0.23
65 0.24
66 0.25
67 0.25
68 0.25
69 0.24
70 0.15
71 0.1
72 0.11
73 0.09
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.34
97 0.39
98 0.4
99 0.39
100 0.4
101 0.41
102 0.36
103 0.3
104 0.27
105 0.27
106 0.33
107 0.41
108 0.45
109 0.46
110 0.55
111 0.58