Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9X8J4

Protein Details
Accession W9X8J4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
63-85RSAGKPGKPKRGRNPRAKPKTAEBasic
NLS Segment(s)
PositionSequence
30-30K
36-82KTSANPKAQPKSATATKKVTGKDGTKGRSAGKPGKPKRGRNPRAKPK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MDASSVPEPAPAKSLAERVAYANPPKRSGKSEPLTKTSANPKAQPKSATATKKVTGKDGTKGRSAGKPGKPKRGRNPRAKPKTAEELDAEMTDYWGGNNPSAVGTTAEAAATNGIAPAANTSDDMGMEEISVSDVEFIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.24
5 0.23
6 0.27
7 0.29
8 0.35
9 0.39
10 0.39
11 0.42
12 0.45
13 0.46
14 0.47
15 0.5
16 0.52
17 0.52
18 0.59
19 0.59
20 0.59
21 0.59
22 0.53
23 0.51
24 0.51
25 0.51
26 0.45
27 0.46
28 0.5
29 0.52
30 0.55
31 0.52
32 0.45
33 0.44
34 0.47
35 0.47
36 0.43
37 0.42
38 0.41
39 0.44
40 0.42
41 0.4
42 0.38
43 0.35
44 0.37
45 0.39
46 0.38
47 0.36
48 0.37
49 0.35
50 0.33
51 0.35
52 0.36
53 0.37
54 0.45
55 0.48
56 0.57
57 0.63
58 0.67
59 0.73
60 0.76
61 0.79
62 0.79
63 0.85
64 0.85
65 0.87
66 0.84
67 0.77
68 0.71
69 0.72
70 0.62
71 0.53
72 0.43
73 0.36
74 0.32
75 0.28
76 0.24
77 0.14
78 0.13
79 0.1
80 0.08
81 0.06
82 0.08
83 0.09
84 0.08
85 0.09
86 0.09
87 0.09
88 0.1
89 0.1
90 0.08
91 0.07
92 0.08
93 0.08
94 0.08
95 0.07
96 0.07
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.07
107 0.07
108 0.08
109 0.09
110 0.09
111 0.1
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06