Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WU91

Protein Details
Accession W9WU91   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-142GKVCKAYCDKRVKDHRKIRFLHKGQKNLRRYABasic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MVKEVDHTAVFQYGSNVIVGMNADATVRELRSQLEDLMGKSSATYLIGFMGSILQDEARVFDNSKAFYGLDKKSTVYVQHFSIFDDVRITIQVRDDNGRLYFKATTRTQFGKVCKAYCDKRVKDHRKIRFLHKGQKNLRRYAVPICWH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.08
5 0.08
6 0.08
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.08
13 0.09
14 0.09
15 0.1
16 0.1
17 0.11
18 0.15
19 0.16
20 0.14
21 0.16
22 0.17
23 0.17
24 0.18
25 0.18
26 0.14
27 0.12
28 0.12
29 0.09
30 0.08
31 0.08
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.06
45 0.07
46 0.08
47 0.09
48 0.11
49 0.14
50 0.14
51 0.14
52 0.14
53 0.12
54 0.13
55 0.17
56 0.16
57 0.16
58 0.16
59 0.16
60 0.17
61 0.17
62 0.18
63 0.16
64 0.17
65 0.16
66 0.18
67 0.18
68 0.17
69 0.19
70 0.16
71 0.13
72 0.12
73 0.11
74 0.09
75 0.1
76 0.1
77 0.08
78 0.1
79 0.11
80 0.12
81 0.14
82 0.15
83 0.16
84 0.17
85 0.18
86 0.17
87 0.18
88 0.19
89 0.17
90 0.24
91 0.24
92 0.25
93 0.29
94 0.32
95 0.34
96 0.37
97 0.4
98 0.42
99 0.44
100 0.42
101 0.42
102 0.46
103 0.46
104 0.5
105 0.57
106 0.51
107 0.58
108 0.68
109 0.73
110 0.76
111 0.81
112 0.81
113 0.8
114 0.82
115 0.82
116 0.82
117 0.81
118 0.81
119 0.79
120 0.8
121 0.8
122 0.85
123 0.82
124 0.78
125 0.76
126 0.69
127 0.64
128 0.62