Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9VZI5

Protein Details
Accession W9VZI5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-87MSNRAAKKVGTRRRRAQGHTHydrophilic
NLS Segment(s)
PositionSequence
74-82KKVGTRRRR
Subcellular Location(s) cyto 8.5, cyto_nucl 8, nucl 6.5, mito 6, pero 5
Family & Domain DBs
Amino Acid Sequences MEHRSVSNLDELEQLVPPRRAAPDSIRQIQRPQLGQLVSEMAMGVELPRKRIGLTPVARDKFGVPILMSNRAAKKVGTRRRRAQGHTEPPHTRFPASIAPWPLPVPLSVPAPAVFSAESPQPKGDRRDKSNRNSNDNDSGNNNAATAGGVQAREPGGGGSESGETNGGQRGHAGKLTLVSAGQLEDLRADLIQSARENSDLRHKVDMLERKLARAEDQRETYWACGVEWARREKGLRSELEHWRAQAEVATKRGSAVEGAATYGFVGVRGFGGRDKLDEGQGHGPGLGLQFEIGFDAEDSGTDFDTGFDADFGTDFGADPGLFTAAGGGEELDKERGAMLWMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.23
5 0.25
6 0.27
7 0.27
8 0.3
9 0.35
10 0.39
11 0.46
12 0.54
13 0.57
14 0.56
15 0.59
16 0.62
17 0.61
18 0.53
19 0.47
20 0.44
21 0.39
22 0.37
23 0.33
24 0.28
25 0.22
26 0.19
27 0.16
28 0.09
29 0.09
30 0.08
31 0.08
32 0.11
33 0.12
34 0.14
35 0.16
36 0.17
37 0.18
38 0.23
39 0.26
40 0.3
41 0.35
42 0.42
43 0.5
44 0.51
45 0.5
46 0.47
47 0.43
48 0.37
49 0.33
50 0.26
51 0.16
52 0.2
53 0.22
54 0.27
55 0.28
56 0.28
57 0.3
58 0.3
59 0.31
60 0.26
61 0.33
62 0.37
63 0.46
64 0.52
65 0.58
66 0.65
67 0.74
68 0.81
69 0.77
70 0.77
71 0.78
72 0.79
73 0.78
74 0.77
75 0.72
76 0.67
77 0.69
78 0.6
79 0.5
80 0.39
81 0.35
82 0.34
83 0.32
84 0.34
85 0.29
86 0.29
87 0.29
88 0.29
89 0.26
90 0.19
91 0.16
92 0.13
93 0.12
94 0.13
95 0.12
96 0.13
97 0.13
98 0.13
99 0.13
100 0.12
101 0.1
102 0.09
103 0.1
104 0.13
105 0.14
106 0.13
107 0.15
108 0.18
109 0.22
110 0.29
111 0.36
112 0.41
113 0.48
114 0.57
115 0.64
116 0.71
117 0.76
118 0.75
119 0.74
120 0.7
121 0.67
122 0.64
123 0.56
124 0.48
125 0.4
126 0.36
127 0.29
128 0.25
129 0.2
130 0.12
131 0.11
132 0.09
133 0.08
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.06
151 0.05
152 0.06
153 0.09
154 0.09
155 0.08
156 0.09
157 0.11
158 0.11
159 0.12
160 0.11
161 0.08
162 0.09
163 0.09
164 0.08
165 0.06
166 0.06
167 0.05
168 0.05
169 0.06
170 0.05
171 0.04
172 0.04
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.05
179 0.07
180 0.07
181 0.08
182 0.08
183 0.1
184 0.1
185 0.1
186 0.2
187 0.22
188 0.24
189 0.25
190 0.25
191 0.26
192 0.32
193 0.39
194 0.32
195 0.37
196 0.35
197 0.34
198 0.36
199 0.34
200 0.31
201 0.31
202 0.32
203 0.29
204 0.32
205 0.31
206 0.31
207 0.32
208 0.28
209 0.23
210 0.19
211 0.13
212 0.15
213 0.15
214 0.18
215 0.22
216 0.26
217 0.24
218 0.27
219 0.28
220 0.28
221 0.34
222 0.36
223 0.34
224 0.35
225 0.41
226 0.46
227 0.5
228 0.48
229 0.4
230 0.34
231 0.32
232 0.27
233 0.23
234 0.2
235 0.18
236 0.2
237 0.21
238 0.2
239 0.2
240 0.2
241 0.18
242 0.13
243 0.11
244 0.1
245 0.08
246 0.09
247 0.09
248 0.08
249 0.08
250 0.08
251 0.07
252 0.05
253 0.05
254 0.04
255 0.05
256 0.06
257 0.07
258 0.07
259 0.11
260 0.11
261 0.13
262 0.16
263 0.17
264 0.2
265 0.2
266 0.23
267 0.24
268 0.25
269 0.23
270 0.2
271 0.19
272 0.15
273 0.15
274 0.11
275 0.07
276 0.06
277 0.06
278 0.06
279 0.07
280 0.06
281 0.06
282 0.05
283 0.07
284 0.06
285 0.06
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.07
292 0.08
293 0.09
294 0.07
295 0.07
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.06
302 0.06
303 0.06
304 0.08
305 0.07
306 0.07
307 0.08
308 0.08
309 0.08
310 0.07
311 0.08
312 0.06
313 0.07
314 0.07
315 0.06
316 0.06
317 0.07
318 0.1
319 0.1
320 0.1
321 0.1
322 0.1
323 0.1