Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XC99

Protein Details
Accession W9XC99   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-59ARGSAGRPPRNPRHPLRRHKVFDRGFBasic
NLS Segment(s)
PositionSequence
39-52GRPPRNPRHPLRRH
Subcellular Location(s) nucl 20, cyto 5.5, cyto_mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MAENARGNATLAPGTVPEMELSHCAGVCISLQEARGSAGRPPRNPRHPLRRHKVFDRGFNEPNAFGTLLPKQFLSIKTPTPKFKFHKKVDEGPASWRISHEQPSYHSSTSNQSQSHEPYPFPDISVDAEGQAMVELTESISAGYTSPSPYLYTWLALRLHSIRSAVKIKRKTTRRPIDAAVANLPPTNEEAQKSAKTAVEYLIFRDFAWGLLYLAEVPSVQDKLRDRMRSAFGDAAPENRPSTLDKIVKTSNLYLQAVIEEIPPKFVRALSLPCSSVILVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.1
5 0.1
6 0.11
7 0.12
8 0.14
9 0.13
10 0.12
11 0.12
12 0.11
13 0.11
14 0.1
15 0.1
16 0.09
17 0.1
18 0.11
19 0.12
20 0.12
21 0.13
22 0.14
23 0.14
24 0.18
25 0.25
26 0.31
27 0.37
28 0.46
29 0.55
30 0.63
31 0.7
32 0.75
33 0.77
34 0.81
35 0.86
36 0.87
37 0.87
38 0.85
39 0.84
40 0.84
41 0.79
42 0.78
43 0.72
44 0.69
45 0.61
46 0.56
47 0.52
48 0.41
49 0.37
50 0.29
51 0.24
52 0.17
53 0.17
54 0.19
55 0.18
56 0.18
57 0.17
58 0.16
59 0.19
60 0.21
61 0.23
62 0.22
63 0.27
64 0.35
65 0.41
66 0.48
67 0.48
68 0.56
69 0.57
70 0.64
71 0.68
72 0.67
73 0.72
74 0.7
75 0.75
76 0.75
77 0.75
78 0.65
79 0.6
80 0.59
81 0.5
82 0.43
83 0.35
84 0.3
85 0.26
86 0.31
87 0.28
88 0.23
89 0.25
90 0.3
91 0.33
92 0.3
93 0.28
94 0.23
95 0.26
96 0.29
97 0.31
98 0.26
99 0.24
100 0.27
101 0.3
102 0.33
103 0.29
104 0.25
105 0.21
106 0.24
107 0.23
108 0.2
109 0.16
110 0.13
111 0.12
112 0.14
113 0.12
114 0.08
115 0.08
116 0.07
117 0.07
118 0.06
119 0.04
120 0.03
121 0.03
122 0.02
123 0.02
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.1
138 0.1
139 0.1
140 0.1
141 0.13
142 0.13
143 0.12
144 0.15
145 0.13
146 0.14
147 0.13
148 0.15
149 0.12
150 0.16
151 0.23
152 0.26
153 0.32
154 0.39
155 0.44
156 0.51
157 0.59
158 0.65
159 0.69
160 0.74
161 0.71
162 0.69
163 0.65
164 0.64
165 0.58
166 0.5
167 0.42
168 0.32
169 0.27
170 0.23
171 0.2
172 0.13
173 0.13
174 0.13
175 0.12
176 0.12
177 0.14
178 0.18
179 0.19
180 0.2
181 0.2
182 0.19
183 0.19
184 0.19
185 0.18
186 0.19
187 0.18
188 0.19
189 0.2
190 0.18
191 0.17
192 0.18
193 0.16
194 0.12
195 0.13
196 0.11
197 0.08
198 0.08
199 0.08
200 0.07
201 0.07
202 0.06
203 0.05
204 0.05
205 0.07
206 0.08
207 0.08
208 0.13
209 0.16
210 0.23
211 0.31
212 0.35
213 0.36
214 0.41
215 0.46
216 0.44
217 0.45
218 0.43
219 0.35
220 0.37
221 0.34
222 0.31
223 0.28
224 0.27
225 0.24
226 0.2
227 0.21
228 0.19
229 0.23
230 0.28
231 0.31
232 0.3
233 0.35
234 0.38
235 0.4
236 0.4
237 0.39
238 0.35
239 0.36
240 0.35
241 0.3
242 0.28
243 0.25
244 0.22
245 0.19
246 0.16
247 0.13
248 0.13
249 0.17
250 0.17
251 0.18
252 0.19
253 0.19
254 0.2
255 0.22
256 0.28
257 0.29
258 0.33
259 0.32
260 0.32
261 0.33
262 0.29