Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9X214

Protein Details
Accession W9X214    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-33QVNVPKTRRTYCKGKTCKKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences RQVNVPKTRRTYCKGKTCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.83
4 0.85
5 0.89
6 0.88
7 0.89
8 0.89
9 0.89
10 0.88
11 0.88
12 0.89
13 0.82
14 0.82
15 0.75
16 0.7
17 0.62
18 0.56
19 0.45
20 0.36
21 0.34
22 0.34
23 0.33
24 0.29
25 0.34
26 0.38
27 0.42
28 0.47
29 0.52
30 0.48
31 0.55
32 0.62
33 0.59
34 0.61
35 0.59
36 0.58
37 0.57
38 0.59
39 0.5
40 0.44
41 0.4
42 0.33
43 0.35
44 0.36
45 0.35
46 0.3
47 0.37
48 0.41
49 0.5
50 0.58
51 0.61
52 0.61
53 0.64
54 0.71
55 0.72
56 0.71
57 0.67
58 0.62
59 0.59
60 0.58
61 0.52
62 0.48
63 0.45
64 0.39
65 0.33
66 0.31
67 0.3
68 0.35
69 0.41
70 0.44
71 0.47
72 0.57
73 0.64
74 0.7
75 0.67
76 0.61
77 0.58
78 0.54
79 0.53
80 0.53
81 0.53
82 0.54
83 0.57
84 0.54
85 0.5
86 0.48
87 0.42