Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9X9G6

Protein Details
Accession W9X9G6    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
186-212DECETVEKPPKRRRAERNLQPPPRTVRHydrophilic
NLS Segment(s)
PositionSequence
141-180KRPPKGSGRRRTKNGPATPSKASKSASNATPPAKITKKRK
194-202PPKRRRAER
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MNDQTAGRGAMRSDSEGVSAASPNNNPKTRKRGVRAGADQVAGRREKLSNAQPSTVPAVRGALEIPGHRLLPQQLATDEASPLLTQGWQDLPIYDSETGPWGPGKPLTDDGTWGKGLALSDEDLENWKTASWESYNPPLVKRPPKGSGRRRTKNGPATPSKASKSASNATPPAKITKKRKGVVTDDECETVEKPPKRRRAERNLQPPPRTVRTNLQAKTRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.18
5 0.15
6 0.15
7 0.14
8 0.15
9 0.17
10 0.24
11 0.31
12 0.37
13 0.41
14 0.47
15 0.55
16 0.61
17 0.68
18 0.68
19 0.69
20 0.71
21 0.76
22 0.74
23 0.73
24 0.67
25 0.58
26 0.52
27 0.44
28 0.42
29 0.32
30 0.27
31 0.21
32 0.19
33 0.2
34 0.26
35 0.32
36 0.36
37 0.38
38 0.39
39 0.37
40 0.39
41 0.42
42 0.37
43 0.29
44 0.2
45 0.19
46 0.17
47 0.17
48 0.15
49 0.11
50 0.11
51 0.11
52 0.13
53 0.13
54 0.13
55 0.13
56 0.15
57 0.14
58 0.16
59 0.18
60 0.16
61 0.15
62 0.17
63 0.18
64 0.16
65 0.15
66 0.11
67 0.1
68 0.08
69 0.08
70 0.06
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.1
81 0.09
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.09
88 0.07
89 0.07
90 0.09
91 0.1
92 0.1
93 0.13
94 0.15
95 0.14
96 0.16
97 0.17
98 0.17
99 0.16
100 0.14
101 0.12
102 0.1
103 0.1
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.08
112 0.07
113 0.07
114 0.07
115 0.06
116 0.07
117 0.09
118 0.09
119 0.11
120 0.14
121 0.19
122 0.25
123 0.25
124 0.26
125 0.29
126 0.35
127 0.4
128 0.43
129 0.43
130 0.46
131 0.54
132 0.64
133 0.69
134 0.72
135 0.75
136 0.79
137 0.79
138 0.79
139 0.8
140 0.8
141 0.76
142 0.74
143 0.7
144 0.66
145 0.65
146 0.63
147 0.55
148 0.48
149 0.43
150 0.38
151 0.37
152 0.37
153 0.35
154 0.35
155 0.38
156 0.36
157 0.37
158 0.35
159 0.37
160 0.4
161 0.45
162 0.49
163 0.55
164 0.63
165 0.65
166 0.7
167 0.69
168 0.69
169 0.71
170 0.68
171 0.62
172 0.55
173 0.51
174 0.45
175 0.39
176 0.33
177 0.28
178 0.3
179 0.32
180 0.39
181 0.47
182 0.56
183 0.65
184 0.74
185 0.79
186 0.82
187 0.87
188 0.88
189 0.9
190 0.91
191 0.91
192 0.85
193 0.81
194 0.78
195 0.74
196 0.68
197 0.61
198 0.6
199 0.6
200 0.66
201 0.64
202 0.65