Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9X4E2

Protein Details
Accession W9X4E2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MDKFRSGRKWLKGKLRGRLQRTPKERKIBasic
NLS Segment(s)
PositionSequence
5-27RSGRKWLKGKLRGRLQRTPKERK
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MDKFRSGRKWLKGKLRGRLQRTPKERKIIIGHPTDFRRENITLGTDVDGNTTLVEKAREDAQATYIASKTQPPGNTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.82
4 0.79
5 0.8
6 0.79
7 0.79
8 0.81
9 0.81
10 0.77
11 0.77
12 0.7
13 0.67
14 0.63
15 0.59
16 0.56
17 0.52
18 0.47
19 0.43
20 0.44
21 0.42
22 0.37
23 0.31
24 0.29
25 0.24
26 0.22
27 0.19
28 0.18
29 0.15
30 0.14
31 0.14
32 0.1
33 0.09
34 0.09
35 0.09
36 0.07
37 0.07
38 0.07
39 0.06
40 0.07
41 0.08
42 0.08
43 0.09
44 0.11
45 0.12
46 0.14
47 0.14
48 0.15
49 0.17
50 0.17
51 0.18
52 0.16
53 0.16
54 0.15
55 0.17
56 0.19
57 0.22