Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9XDF5

Protein Details
Accession W9XDF5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAASSGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-24GGKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12, nucl 11, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAASSGGKKQKKKWSKGKVKDKANHAVVLDKATSDKLNKDVQSYRLITVAVLVDRLKINGSLARKALADLEERGVIRKVVAHSKGSIYTRAAAGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.86
5 0.91
6 0.93
7 0.92
8 0.92
9 0.88
10 0.84
11 0.82
12 0.74
13 0.66
14 0.55
15 0.49
16 0.39
17 0.34
18 0.26
19 0.17
20 0.15
21 0.13
22 0.14
23 0.12
24 0.13
25 0.14
26 0.19
27 0.2
28 0.23
29 0.25
30 0.26
31 0.3
32 0.3
33 0.26
34 0.22
35 0.21
36 0.17
37 0.15
38 0.13
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.08
48 0.1
49 0.13
50 0.14
51 0.15
52 0.16
53 0.15
54 0.16
55 0.16
56 0.14
57 0.14
58 0.13
59 0.14
60 0.16
61 0.16
62 0.17
63 0.16
64 0.15
65 0.13
66 0.15
67 0.17
68 0.23
69 0.27
70 0.27
71 0.28
72 0.31
73 0.37
74 0.35
75 0.35
76 0.29
77 0.28
78 0.26