Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2ANF6

Protein Details
Accession B2ANF6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
88-114GIVDPKYQKTPPRKSTPKKEKAAPAEAHydrophilic
NLS Segment(s)
PositionSequence
99-109PRKSTPKKEKA
Subcellular Location(s) mito 18, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000307  Ribosomal_S16  
IPR020592  Ribosomal_S16_CS  
IPR023803  Ribosomal_S16_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pan:PODANS72p281  -  
Pfam View protein in Pfam  
PF00886  Ribosomal_S16  
PROSITE View protein in PROSITE  
PS00732  RIBOSOMAL_S16  
Amino Acid Sequences MVVKIRLARFGRTNSPFYNIVVAHARTARNSRPLEVIGTYDPIPKKDTYDESGRLHKDIKLDISRAQYWIGVGAQPTETATRLLSMVGIVDPKYQKTPPRKSTPKKEKAAPAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.44
4 0.39
5 0.38
6 0.28
7 0.26
8 0.27
9 0.25
10 0.23
11 0.25
12 0.25
13 0.23
14 0.28
15 0.29
16 0.32
17 0.33
18 0.32
19 0.32
20 0.32
21 0.31
22 0.27
23 0.25
24 0.17
25 0.18
26 0.17
27 0.18
28 0.18
29 0.17
30 0.19
31 0.17
32 0.18
33 0.2
34 0.23
35 0.22
36 0.27
37 0.3
38 0.3
39 0.36
40 0.34
41 0.32
42 0.3
43 0.27
44 0.23
45 0.2
46 0.22
47 0.19
48 0.19
49 0.22
50 0.25
51 0.24
52 0.23
53 0.22
54 0.17
55 0.15
56 0.14
57 0.11
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.07
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.11
78 0.13
79 0.15
80 0.19
81 0.22
82 0.3
83 0.39
84 0.49
85 0.55
86 0.64
87 0.74
88 0.8
89 0.88
90 0.91
91 0.91
92 0.89
93 0.88
94 0.87