Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XH43

Protein Details
Accession W9XH43   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-90EDEKKTPPSKRARKPKQKSFDGIBasic
NLS Segment(s)
PositionSequence
70-85EKKTPPSKRARKPKQK
Subcellular Location(s) nucl 12, mito_nucl 10.333, cyto_nucl 9.333, mito 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MLLFAIFSANLRPSADTWQRVAALLGEGLTASAVSQKYYKLRHEMEKMLKDQGAPTPTTPTKRKAEDEDEKKTPPSKRARKPKQKSFDGIPFTQVPDSPQKVKYEDMAVSGLDSFHSYDAHFTPTAFFPAVNMGELMNGQRSGNSSSSSFMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.3
4 0.31
5 0.33
6 0.32
7 0.31
8 0.3
9 0.22
10 0.16
11 0.13
12 0.11
13 0.07
14 0.07
15 0.06
16 0.05
17 0.04
18 0.03
19 0.07
20 0.07
21 0.08
22 0.09
23 0.12
24 0.18
25 0.23
26 0.27
27 0.31
28 0.35
29 0.42
30 0.47
31 0.52
32 0.55
33 0.56
34 0.54
35 0.49
36 0.45
37 0.38
38 0.33
39 0.3
40 0.24
41 0.19
42 0.18
43 0.21
44 0.23
45 0.29
46 0.31
47 0.33
48 0.36
49 0.39
50 0.41
51 0.41
52 0.47
53 0.51
54 0.55
55 0.55
56 0.53
57 0.5
58 0.48
59 0.47
60 0.41
61 0.39
62 0.43
63 0.47
64 0.53
65 0.64
66 0.73
67 0.79
68 0.87
69 0.89
70 0.88
71 0.84
72 0.79
73 0.73
74 0.7
75 0.64
76 0.54
77 0.47
78 0.38
79 0.33
80 0.29
81 0.23
82 0.18
83 0.2
84 0.23
85 0.23
86 0.25
87 0.26
88 0.28
89 0.29
90 0.28
91 0.25
92 0.22
93 0.2
94 0.19
95 0.16
96 0.14
97 0.13
98 0.11
99 0.08
100 0.08
101 0.07
102 0.06
103 0.07
104 0.07
105 0.09
106 0.1
107 0.14
108 0.13
109 0.13
110 0.15
111 0.15
112 0.18
113 0.16
114 0.14
115 0.11
116 0.16
117 0.16
118 0.14
119 0.14
120 0.11
121 0.11
122 0.12
123 0.13
124 0.1
125 0.11
126 0.1
127 0.11
128 0.13
129 0.17
130 0.19
131 0.2
132 0.18