Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9W9F8

Protein Details
Accession W9W9F8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-116QRQISLERRKQLKKQKPPKPKPATPRTTRARSTHydrophilic
NLS Segment(s)
PositionSequence
90-122ERRKQLKKQKPPKPKPATPRTTRARSTLKRRAM
Subcellular Location(s) mito 13.5mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MVRSNHSRPIPIQIWEKHKFTIYELYARLPLDEVMAEMRQKHDFVATAQQYKRQLGKWGLRKNVLMELEVIDDESIARGGKISQRQISLERRKQLKKQKPPKPKPATPRTTRARSTLKRRAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.55
4 0.47
5 0.47
6 0.43
7 0.37
8 0.4
9 0.34
10 0.34
11 0.33
12 0.33
13 0.32
14 0.31
15 0.28
16 0.2
17 0.17
18 0.12
19 0.11
20 0.09
21 0.08
22 0.09
23 0.1
24 0.09
25 0.12
26 0.12
27 0.12
28 0.12
29 0.11
30 0.11
31 0.12
32 0.2
33 0.21
34 0.26
35 0.26
36 0.3
37 0.31
38 0.33
39 0.34
40 0.27
41 0.3
42 0.3
43 0.38
44 0.42
45 0.47
46 0.48
47 0.48
48 0.47
49 0.42
50 0.4
51 0.33
52 0.24
53 0.17
54 0.14
55 0.13
56 0.12
57 0.11
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.04
66 0.05
67 0.1
68 0.16
69 0.21
70 0.23
71 0.25
72 0.28
73 0.34
74 0.43
75 0.49
76 0.51
77 0.54
78 0.59
79 0.64
80 0.71
81 0.76
82 0.77
83 0.77
84 0.81
85 0.84
86 0.87
87 0.91
88 0.93
89 0.92
90 0.9
91 0.9
92 0.9
93 0.9
94 0.85
95 0.85
96 0.83
97 0.81
98 0.76
99 0.73
100 0.73
101 0.72
102 0.76