Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B274

Protein Details
Accession B2B274    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-105NPITRRPGPGRGRPRKNPAPPTAHydrophilic
NLS Segment(s)
PositionSequence
87-100RRPGPGRGRPRKNP
Subcellular Location(s) extr 18, cyto_mito 4, mito 3.5, cyto 3.5
Family & Domain DBs
KEGG pan:PODANSg7112  -  
Amino Acid Sequences MNKNWNDRADKDLFFTILSVKNIGVISGSEWTTIGNHMRSMGYGFTNEGCRQHFQGLRRAQNKADSSTVNPDNSPRKIDPTLNPITRRPGPGRGRPRKNPAPPTAADHAAAAAAAAIAAAGPGQAPGVAPGGGPGLAPSVAPGPVPGVAPGPPGVAPVSSAPPTPQQITSVPVPVIPGMPAPPPGVQMHPMYAQNVQAQVQTPVRPPSRPINAGGAPPAQMESPDDLAVDPNLEDDSDEHMAKRQRLDDSQSGSLDDEAMMNALSAHNEPTPGDYSQDFSSYGEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.24
4 0.23
5 0.23
6 0.2
7 0.18
8 0.2
9 0.2
10 0.19
11 0.15
12 0.11
13 0.11
14 0.13
15 0.14
16 0.11
17 0.11
18 0.11
19 0.11
20 0.14
21 0.17
22 0.15
23 0.15
24 0.16
25 0.17
26 0.17
27 0.18
28 0.16
29 0.13
30 0.13
31 0.13
32 0.14
33 0.18
34 0.2
35 0.21
36 0.22
37 0.24
38 0.26
39 0.31
40 0.34
41 0.33
42 0.4
43 0.46
44 0.53
45 0.55
46 0.55
47 0.51
48 0.54
49 0.54
50 0.48
51 0.43
52 0.35
53 0.34
54 0.38
55 0.4
56 0.33
57 0.3
58 0.32
59 0.36
60 0.36
61 0.38
62 0.32
63 0.34
64 0.36
65 0.41
66 0.39
67 0.4
68 0.47
69 0.47
70 0.48
71 0.45
72 0.48
73 0.46
74 0.47
75 0.43
76 0.44
77 0.46
78 0.53
79 0.62
80 0.66
81 0.72
82 0.75
83 0.81
84 0.81
85 0.82
86 0.81
87 0.76
88 0.71
89 0.63
90 0.61
91 0.55
92 0.46
93 0.37
94 0.28
95 0.22
96 0.16
97 0.14
98 0.08
99 0.04
100 0.03
101 0.02
102 0.02
103 0.02
104 0.01
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.04
130 0.05
131 0.05
132 0.06
133 0.05
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.06
144 0.07
145 0.09
146 0.09
147 0.09
148 0.09
149 0.12
150 0.14
151 0.15
152 0.14
153 0.14
154 0.15
155 0.18
156 0.18
157 0.17
158 0.15
159 0.14
160 0.14
161 0.12
162 0.11
163 0.08
164 0.07
165 0.07
166 0.07
167 0.09
168 0.1
169 0.1
170 0.12
171 0.13
172 0.13
173 0.15
174 0.15
175 0.15
176 0.16
177 0.17
178 0.16
179 0.16
180 0.17
181 0.16
182 0.16
183 0.15
184 0.14
185 0.14
186 0.16
187 0.17
188 0.17
189 0.19
190 0.25
191 0.27
192 0.27
193 0.29
194 0.35
195 0.4
196 0.4
197 0.4
198 0.39
199 0.39
200 0.39
201 0.38
202 0.3
203 0.23
204 0.21
205 0.19
206 0.12
207 0.1
208 0.11
209 0.11
210 0.12
211 0.12
212 0.12
213 0.11
214 0.12
215 0.12
216 0.11
217 0.08
218 0.07
219 0.07
220 0.06
221 0.07
222 0.07
223 0.12
224 0.14
225 0.14
226 0.14
227 0.2
228 0.25
229 0.28
230 0.31
231 0.31
232 0.33
233 0.37
234 0.44
235 0.46
236 0.47
237 0.48
238 0.44
239 0.41
240 0.36
241 0.32
242 0.25
243 0.18
244 0.12
245 0.08
246 0.08
247 0.07
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.1
254 0.1
255 0.11
256 0.12
257 0.15
258 0.18
259 0.17
260 0.19
261 0.18
262 0.21
263 0.21
264 0.23
265 0.2