Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9VNI4

Protein Details
Accession W9VNI4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-86FEDHKRRIHKVEKRPSNPAABasic
NLS Segment(s)
PositionSequence
71-80KRRIHKVEKR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences IVRHERLYQCQEAGHELRPGFTYHGGLLRHEQEVHKMYLSAKKTPIFCSFPNRPRSSGKPYMRKENFEDHKRRIHKVEKRPSNPAASQPQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.25
4 0.25
5 0.25
6 0.25
7 0.21
8 0.19
9 0.17
10 0.14
11 0.19
12 0.18
13 0.18
14 0.2
15 0.2
16 0.2
17 0.2
18 0.19
19 0.2
20 0.22
21 0.22
22 0.19
23 0.17
24 0.18
25 0.22
26 0.25
27 0.22
28 0.23
29 0.25
30 0.26
31 0.29
32 0.32
33 0.3
34 0.29
35 0.34
36 0.39
37 0.43
38 0.51
39 0.49
40 0.48
41 0.49
42 0.54
43 0.55
44 0.57
45 0.58
46 0.6
47 0.62
48 0.7
49 0.69
50 0.67
51 0.62
52 0.63
53 0.63
54 0.63
55 0.66
56 0.6
57 0.66
58 0.66
59 0.67
60 0.64
61 0.66
62 0.66
63 0.69
64 0.75
65 0.77
66 0.78
67 0.81
68 0.78
69 0.75
70 0.68
71 0.66