Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9XNZ4

Protein Details
Accession W9XNZ4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AKSARASVVKKNHRNLRAKVHydrophilic
91-113ASSRVNHKVRKVSKRNSKNSVVFHydrophilic
NLS Segment(s)
PositionSequence
100-108RKVSKRNSK
116-130EIARKKKIARNKAKR
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASVVKKNHRNLRAKVYGPASDARTARLSAKLQELAAKPKPETEKVMDVDDKAGSAAGGQPHRSSSEVMDVDAQGPSMKPVKSSTASSRVNHKVRKVSKRNSKNSVVFASEIARKKKIARNKAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.79
4 0.78
5 0.76
6 0.69
7 0.66
8 0.61
9 0.53
10 0.47
11 0.45
12 0.38
13 0.34
14 0.33
15 0.29
16 0.26
17 0.25
18 0.25
19 0.26
20 0.25
21 0.22
22 0.26
23 0.25
24 0.23
25 0.28
26 0.28
27 0.3
28 0.33
29 0.32
30 0.28
31 0.32
32 0.35
33 0.32
34 0.34
35 0.31
36 0.32
37 0.31
38 0.35
39 0.3
40 0.26
41 0.25
42 0.21
43 0.16
44 0.1
45 0.09
46 0.05
47 0.05
48 0.06
49 0.08
50 0.09
51 0.1
52 0.1
53 0.11
54 0.12
55 0.13
56 0.12
57 0.1
58 0.15
59 0.15
60 0.15
61 0.15
62 0.14
63 0.14
64 0.13
65 0.12
66 0.06
67 0.06
68 0.07
69 0.1
70 0.1
71 0.11
72 0.13
73 0.17
74 0.2
75 0.24
76 0.28
77 0.33
78 0.38
79 0.38
80 0.45
81 0.5
82 0.55
83 0.56
84 0.56
85 0.57
86 0.62
87 0.71
88 0.73
89 0.74
90 0.78
91 0.83
92 0.87
93 0.85
94 0.85
95 0.79
96 0.75
97 0.68
98 0.6
99 0.5
100 0.42
101 0.38
102 0.36
103 0.37
104 0.36
105 0.35
106 0.34
107 0.41
108 0.48
109 0.54
110 0.59