Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WNP9

Protein Details
Accession W9WNP9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65TETWLERNRKKQRRTRILGCTIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 4, cyto 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGVRDPAFWRRFSMAVHLDEEKANISDTRSNSTASSTRALRHTETWLERNRKKQRRTRILGCTIALGFIVVIAAIVLVLLWFAKVGPFKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.33
5 0.31
6 0.29
7 0.27
8 0.27
9 0.2
10 0.15
11 0.14
12 0.11
13 0.12
14 0.16
15 0.17
16 0.21
17 0.21
18 0.21
19 0.2
20 0.23
21 0.23
22 0.2
23 0.22
24 0.19
25 0.2
26 0.22
27 0.24
28 0.22
29 0.22
30 0.23
31 0.24
32 0.25
33 0.28
34 0.33
35 0.4
36 0.42
37 0.5
38 0.58
39 0.62
40 0.69
41 0.73
42 0.76
43 0.79
44 0.83
45 0.82
46 0.81
47 0.79
48 0.73
49 0.64
50 0.55
51 0.44
52 0.35
53 0.26
54 0.16
55 0.09
56 0.06
57 0.05
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.03
71 0.06