Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9XE30

Protein Details
Accession W9XE30    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MIHSRKAKGNRRPVLPKLPLHydrophilic
71-94AAQAYARRPPRRRARRHDPYDHHTBasic
NLS Segment(s)
PositionSequence
77-86RRPPRRRARR
143-153RQRARAKGKIA
Subcellular Location(s) mito 17.5, mito_nucl 14, nucl 9.5
Family & Domain DBs
Amino Acid Sequences MIHSRKAKGNRRPVLPKLPLLPGRLRLSDSDDGHEEDHGEDAEDEEVEEDEDEEAQTQEQELSDVELHDPAAQAYARRPPRRRARRHDPYDHHTSHIATAGHAHAAAMAAAAASAEAEAEAEADEERRDRQRIERLLREMMARQRARAKGKIAKVSKVSPSLSPEEDEEAEQDELMGLIMGSLRREVARADEEAWMFGEPLGVGGIAGRDEIGVYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.73
4 0.66
5 0.66
6 0.61
7 0.57
8 0.54
9 0.51
10 0.5
11 0.46
12 0.44
13 0.36
14 0.39
15 0.41
16 0.38
17 0.34
18 0.32
19 0.32
20 0.3
21 0.29
22 0.22
23 0.16
24 0.15
25 0.11
26 0.1
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.06
58 0.07
59 0.07
60 0.07
61 0.09
62 0.17
63 0.26
64 0.34
65 0.38
66 0.47
67 0.58
68 0.68
69 0.76
70 0.78
71 0.81
72 0.83
73 0.88
74 0.88
75 0.84
76 0.79
77 0.78
78 0.69
79 0.6
80 0.5
81 0.41
82 0.31
83 0.28
84 0.22
85 0.13
86 0.13
87 0.11
88 0.1
89 0.1
90 0.09
91 0.05
92 0.05
93 0.05
94 0.03
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.07
114 0.11
115 0.12
116 0.13
117 0.19
118 0.28
119 0.36
120 0.42
121 0.47
122 0.47
123 0.48
124 0.47
125 0.43
126 0.38
127 0.36
128 0.38
129 0.32
130 0.31
131 0.36
132 0.41
133 0.45
134 0.45
135 0.47
136 0.46
137 0.52
138 0.59
139 0.55
140 0.54
141 0.53
142 0.53
143 0.5
144 0.47
145 0.42
146 0.35
147 0.36
148 0.35
149 0.32
150 0.29
151 0.26
152 0.24
153 0.23
154 0.21
155 0.17
156 0.16
157 0.15
158 0.13
159 0.12
160 0.08
161 0.08
162 0.07
163 0.06
164 0.03
165 0.03
166 0.04
167 0.05
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.09
174 0.13
175 0.16
176 0.17
177 0.19
178 0.22
179 0.22
180 0.22
181 0.22
182 0.18
183 0.15
184 0.13
185 0.12
186 0.07
187 0.08
188 0.07
189 0.06
190 0.05
191 0.05
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05