Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2ACN9

Protein Details
Accession B2ACN9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
256-285VNKSEIPTKKRGPGRPKKQQKERKILTSVGHydrophilic
NLS Segment(s)
PositionSequence
263-290TKKRGPGRPKKQQKERKILTSVGRTARK
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 10
Family & Domain DBs
KEGG pan:PODANSg444  -  
Amino Acid Sequences MSGEAEKVTHQELTSAPPAWSTDVGETSKLADINAVANGDVDNKATGDNDKTGQVAPVASGGPVESRIAAPSSATLTPAPAPAPAPAPASAPTSESLAEPSTSEENLDSAKTEPSGQTKATPPESVTLPAALVKTVTNGTTKDVETTDTPQKSTEAATSDVSAESTEVNTDKVAEDAKNDKAAHAPAVSANGNTRDDDAEMGEAPVAPDSTAATKTAASIPPLGGGKRKAEEAFGDSNGDLGETQAQPEISITNAVNKSEIPTKKRGPGRPKKQQKERKILTSVGRTARKTRSQGPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.21
5 0.22
6 0.23
7 0.23
8 0.19
9 0.18
10 0.2
11 0.21
12 0.21
13 0.2
14 0.19
15 0.2
16 0.18
17 0.16
18 0.12
19 0.12
20 0.12
21 0.14
22 0.12
23 0.09
24 0.09
25 0.1
26 0.11
27 0.1
28 0.1
29 0.09
30 0.08
31 0.09
32 0.1
33 0.12
34 0.13
35 0.15
36 0.16
37 0.16
38 0.17
39 0.18
40 0.17
41 0.16
42 0.13
43 0.1
44 0.1
45 0.1
46 0.08
47 0.08
48 0.07
49 0.07
50 0.08
51 0.08
52 0.07
53 0.07
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.12
60 0.11
61 0.12
62 0.11
63 0.12
64 0.12
65 0.13
66 0.13
67 0.1
68 0.11
69 0.1
70 0.12
71 0.12
72 0.14
73 0.13
74 0.14
75 0.15
76 0.17
77 0.16
78 0.15
79 0.14
80 0.13
81 0.13
82 0.12
83 0.12
84 0.1
85 0.1
86 0.09
87 0.11
88 0.11
89 0.11
90 0.11
91 0.09
92 0.09
93 0.09
94 0.09
95 0.08
96 0.07
97 0.08
98 0.08
99 0.09
100 0.1
101 0.13
102 0.16
103 0.15
104 0.17
105 0.21
106 0.25
107 0.26
108 0.25
109 0.22
110 0.22
111 0.22
112 0.21
113 0.17
114 0.13
115 0.11
116 0.11
117 0.11
118 0.08
119 0.08
120 0.06
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.1
127 0.12
128 0.12
129 0.12
130 0.12
131 0.12
132 0.12
133 0.16
134 0.21
135 0.19
136 0.2
137 0.19
138 0.19
139 0.18
140 0.18
141 0.15
142 0.11
143 0.12
144 0.12
145 0.12
146 0.12
147 0.11
148 0.11
149 0.09
150 0.07
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.08
161 0.07
162 0.09
163 0.12
164 0.14
165 0.18
166 0.18
167 0.18
168 0.19
169 0.19
170 0.18
171 0.15
172 0.14
173 0.1
174 0.13
175 0.13
176 0.11
177 0.12
178 0.13
179 0.14
180 0.14
181 0.14
182 0.12
183 0.12
184 0.12
185 0.11
186 0.09
187 0.08
188 0.08
189 0.07
190 0.06
191 0.06
192 0.06
193 0.06
194 0.04
195 0.04
196 0.05
197 0.07
198 0.08
199 0.08
200 0.09
201 0.09
202 0.1
203 0.14
204 0.15
205 0.14
206 0.15
207 0.14
208 0.17
209 0.19
210 0.18
211 0.19
212 0.2
213 0.22
214 0.23
215 0.26
216 0.23
217 0.23
218 0.25
219 0.26
220 0.26
221 0.23
222 0.23
223 0.2
224 0.2
225 0.17
226 0.16
227 0.1
228 0.07
229 0.11
230 0.09
231 0.1
232 0.11
233 0.11
234 0.11
235 0.12
236 0.11
237 0.08
238 0.11
239 0.1
240 0.17
241 0.19
242 0.19
243 0.19
244 0.19
245 0.22
246 0.28
247 0.34
248 0.32
249 0.39
250 0.45
251 0.53
252 0.62
253 0.68
254 0.7
255 0.75
256 0.81
257 0.84
258 0.89
259 0.91
260 0.94
261 0.95
262 0.94
263 0.94
264 0.92
265 0.9
266 0.84
267 0.79
268 0.76
269 0.74
270 0.71
271 0.69
272 0.67
273 0.62
274 0.64
275 0.66
276 0.66
277 0.64