Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9X6I3

Protein Details
Accession W9X6I3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30SQTHQAKQPSNPRARRIRNKEWEALRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MADASQTHQAKQPSNPRARRIRNKEWEALRPEIEKLYLEQGNSRKAVVERLSQNGFPVTPCQSQLAHAHRTESEKQLKQILQKWGSKKNLSSTDMQKMLAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.68
4 0.74
5 0.81
6 0.84
7 0.83
8 0.84
9 0.84
10 0.83
11 0.82
12 0.77
13 0.74
14 0.68
15 0.62
16 0.53
17 0.44
18 0.39
19 0.32
20 0.27
21 0.2
22 0.16
23 0.17
24 0.16
25 0.15
26 0.18
27 0.2
28 0.23
29 0.23
30 0.22
31 0.18
32 0.17
33 0.22
34 0.19
35 0.21
36 0.2
37 0.24
38 0.25
39 0.23
40 0.23
41 0.2
42 0.17
43 0.12
44 0.13
45 0.13
46 0.13
47 0.14
48 0.15
49 0.15
50 0.18
51 0.24
52 0.27
53 0.27
54 0.27
55 0.28
56 0.27
57 0.33
58 0.33
59 0.34
60 0.38
61 0.37
62 0.39
63 0.44
64 0.45
65 0.46
66 0.5
67 0.51
68 0.49
69 0.53
70 0.57
71 0.6
72 0.64
73 0.63
74 0.6
75 0.59
76 0.61
77 0.57
78 0.58
79 0.55
80 0.57
81 0.54