Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9X3S5

Protein Details
Accession W9X3S5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-45KVKSQTPKVEKQEKKKTPKGRAKKRITYTRRFVBasic
NLS Segment(s)
PositionSequence
12-37GKVKSQTPKVEKQEKKKTPKGRAKKR
Subcellular Location(s) mito 15, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRITYTRRFVNVTMTGGKRKVWRLWTPQQGLRGENEMLMLDFYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.47
4 0.51
5 0.55
6 0.64
7 0.67
8 0.73
9 0.74
10 0.76
11 0.79
12 0.8
13 0.83
14 0.82
15 0.83
16 0.83
17 0.86
18 0.87
19 0.87
20 0.88
21 0.88
22 0.88
23 0.87
24 0.87
25 0.84
26 0.81
27 0.76
28 0.73
29 0.68
30 0.6
31 0.52
32 0.47
33 0.41
34 0.36
35 0.34
36 0.28
37 0.27
38 0.26
39 0.28
40 0.27
41 0.29
42 0.33
43 0.35
44 0.41
45 0.47
46 0.56
47 0.63
48 0.64
49 0.64
50 0.65
51 0.6
52 0.54
53 0.48
54 0.42
55 0.33
56 0.27
57 0.23
58 0.17
59 0.15