Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WWD8

Protein Details
Accession W9WWD8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-107ESTPSKKSKATPKKKAVELKGHydrophilic
NLS Segment(s)
PositionSequence
69-102TKAATPRKRKAKGEESADESTPSKKSKATPKKKA
Subcellular Location(s) cyto_nucl 11.5, nucl 10.5, cyto 9.5, mito 6
Family & Domain DBs
Amino Acid Sequences MAPAKGTTDDFTFIMTCLKHADVKPKINFEEVAKEMGAKSGNACYHRHWGIMKKFGLTGSGGGSRPATTKAATPRKRKAKGEESADESTPSKKSKATPKKKAVELKGEETDSEDGVEAKNEVDSPAEDAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.14
5 0.15
6 0.19
7 0.21
8 0.3
9 0.35
10 0.44
11 0.48
12 0.51
13 0.51
14 0.48
15 0.48
16 0.4
17 0.4
18 0.32
19 0.29
20 0.23
21 0.22
22 0.19
23 0.2
24 0.18
25 0.11
26 0.1
27 0.13
28 0.16
29 0.18
30 0.2
31 0.21
32 0.26
33 0.27
34 0.28
35 0.26
36 0.31
37 0.35
38 0.4
39 0.38
40 0.32
41 0.32
42 0.3
43 0.29
44 0.2
45 0.15
46 0.1
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.11
53 0.12
54 0.11
55 0.09
56 0.12
57 0.21
58 0.31
59 0.39
60 0.46
61 0.54
62 0.63
63 0.7
64 0.72
65 0.71
66 0.7
67 0.69
68 0.69
69 0.64
70 0.6
71 0.55
72 0.51
73 0.43
74 0.35
75 0.3
76 0.25
77 0.23
78 0.18
79 0.18
80 0.24
81 0.34
82 0.44
83 0.53
84 0.61
85 0.69
86 0.76
87 0.82
88 0.84
89 0.8
90 0.79
91 0.73
92 0.69
93 0.63
94 0.56
95 0.48
96 0.42
97 0.37
98 0.26
99 0.21
100 0.15
101 0.11
102 0.11
103 0.12
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.1
110 0.1
111 0.14