Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9X5V2

Protein Details
Accession W9X5V2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-66LITQRRKITCKDGKRRTPSDHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, cyto 12.5, nucl 10.5, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007135  Atg3/Atg10  
Gene Ontology GO:0019787  F:ubiquitin-like protein transferase activity  
GO:0006914  P:autophagy  
Pfam View protein in Pfam  
PF03987  Autophagy_act_C  
Amino Acid Sequences IESLRAFPAITQQEFSEACRAWEQRSSDRISETDWLSVRWTGEELLITQRRKITCKDGKRRTPSDHGDAQKDELIDMGIEDSIIKDTLAPDVDNLESLIVDFSITLSPIYSVPVLWFICRYDRVNKALSLDQIYEWLVPEPSLTSLRGIGVMGGISMAHHPVSDRPTFFLHPCKTQEALSVLKPGPLTPEEYLMLWLGLIGSAVGLHVPSKLMSTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.28
4 0.22
5 0.23
6 0.27
7 0.29
8 0.27
9 0.33
10 0.36
11 0.37
12 0.43
13 0.46
14 0.42
15 0.43
16 0.41
17 0.37
18 0.37
19 0.31
20 0.3
21 0.25
22 0.23
23 0.23
24 0.24
25 0.21
26 0.17
27 0.17
28 0.12
29 0.13
30 0.12
31 0.11
32 0.18
33 0.24
34 0.24
35 0.25
36 0.3
37 0.31
38 0.34
39 0.37
40 0.39
41 0.42
42 0.53
43 0.61
44 0.67
45 0.75
46 0.81
47 0.83
48 0.8
49 0.79
50 0.74
51 0.69
52 0.67
53 0.61
54 0.56
55 0.5
56 0.45
57 0.38
58 0.32
59 0.25
60 0.17
61 0.13
62 0.09
63 0.07
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.07
76 0.07
77 0.06
78 0.08
79 0.08
80 0.08
81 0.07
82 0.06
83 0.05
84 0.05
85 0.05
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.06
97 0.05
98 0.05
99 0.05
100 0.08
101 0.09
102 0.08
103 0.09
104 0.09
105 0.11
106 0.14
107 0.16
108 0.18
109 0.22
110 0.25
111 0.27
112 0.27
113 0.28
114 0.27
115 0.26
116 0.23
117 0.19
118 0.16
119 0.15
120 0.15
121 0.12
122 0.1
123 0.09
124 0.07
125 0.06
126 0.07
127 0.06
128 0.08
129 0.09
130 0.09
131 0.09
132 0.09
133 0.1
134 0.1
135 0.09
136 0.07
137 0.06
138 0.05
139 0.04
140 0.04
141 0.03
142 0.03
143 0.04
144 0.05
145 0.04
146 0.04
147 0.05
148 0.09
149 0.13
150 0.17
151 0.17
152 0.19
153 0.23
154 0.26
155 0.28
156 0.34
157 0.33
158 0.35
159 0.38
160 0.4
161 0.38
162 0.36
163 0.37
164 0.32
165 0.31
166 0.28
167 0.3
168 0.26
169 0.27
170 0.27
171 0.22
172 0.23
173 0.21
174 0.24
175 0.18
176 0.22
177 0.2
178 0.21
179 0.22
180 0.18
181 0.16
182 0.11
183 0.1
184 0.07
185 0.05
186 0.05
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.04
193 0.04
194 0.05
195 0.06
196 0.06