Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9WV78

Protein Details
Accession W9WV78    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-76QIDEKPRRKRLSRLLSGGKRBasic
NLS Segment(s)
PositionSequence
61-76KPRRKRLSRLLSGGKR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPSKFTEILDPQYHTTSPQDDVRLEDIIGAADMSSRGRTPSEASSTSPSSSCAEGDQIDEKPRRKRLSRLLSGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.23
4 0.23
5 0.23
6 0.24
7 0.22
8 0.24
9 0.24
10 0.23
11 0.2
12 0.17
13 0.13
14 0.1
15 0.1
16 0.07
17 0.04
18 0.03
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.07
26 0.09
27 0.12
28 0.16
29 0.17
30 0.19
31 0.22
32 0.23
33 0.23
34 0.21
35 0.2
36 0.17
37 0.17
38 0.15
39 0.12
40 0.12
41 0.12
42 0.14
43 0.15
44 0.15
45 0.22
46 0.27
47 0.33
48 0.4
49 0.48
50 0.54
51 0.57
52 0.65
53 0.69
54 0.74
55 0.77
56 0.78