Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2ABB1

Protein Details
Accession B2ABB1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-84RVYRAGRKMTIKKKNTQDRGKPPLPGHydrophilic
NLS Segment(s)
PositionSequence
62-92RAGRKMTIKKKNTQDRGKPPLPGERKAFRKK
Subcellular Location(s) mito 23, cyto_mito 13.833, cyto_nucl 2.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
IPR017082  Ribosomal_S23_mit_fun  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0032543  P:mitochondrial translation  
KEGG pan:PODANSg09940  -  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MSASNCLRCLGRPSVAGASRGVVVPVFAPRTAAPFSTTAVQNALPAKPKSAEHQDRSVRVYRAGRKMTIKKKNTQDRGKPPLPGERKAFRKKIVLSNDNAFPVPWVTEMEASSLSNENKVGSIVSLPPALQDQLRATEAFQPTQTWGLFRKPSTLIRKETVGLTGKMEKAVENKQTARIVLAGEKISGKSTMLLQAQSHAYLNNWIVIHFPDAQELTNGSTEYAPIPNTENPTLYMQQNYCLKLLQSIKKANEKILAKLLSVSNHNELPQNITVNQPLLSLINAAKEAEGAWSVFQALWSELNAQGVNRPPILLSMDNLPHIMKMSEYRSASFDKIHSHDLSLVRLFTEALAGNTRFPSGGAVIAATNRNNGPRIPSMELALKQRLAEQIKVVEGEEAPEPPVRDPYFKGYDDRVEKVLKTVEVIEVNKIGKREARSLMEYWAASGLLRTTVDEQVVSEKWTLGGCGVLGEMERAALLTMKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.4
4 0.34
5 0.3
6 0.27
7 0.26
8 0.22
9 0.13
10 0.11
11 0.11
12 0.15
13 0.15
14 0.14
15 0.16
16 0.16
17 0.2
18 0.22
19 0.21
20 0.19
21 0.18
22 0.2
23 0.24
24 0.25
25 0.22
26 0.22
27 0.21
28 0.22
29 0.24
30 0.26
31 0.27
32 0.27
33 0.29
34 0.3
35 0.31
36 0.35
37 0.43
38 0.5
39 0.48
40 0.57
41 0.61
42 0.61
43 0.65
44 0.65
45 0.56
46 0.53
47 0.56
48 0.55
49 0.57
50 0.58
51 0.58
52 0.61
53 0.69
54 0.73
55 0.75
56 0.73
57 0.73
58 0.79
59 0.84
60 0.85
61 0.85
62 0.85
63 0.85
64 0.88
65 0.83
66 0.78
67 0.71
68 0.71
69 0.66
70 0.62
71 0.59
72 0.58
73 0.63
74 0.68
75 0.7
76 0.65
77 0.67
78 0.67
79 0.69
80 0.7
81 0.66
82 0.61
83 0.6
84 0.58
85 0.51
86 0.45
87 0.35
88 0.26
89 0.21
90 0.17
91 0.13
92 0.11
93 0.1
94 0.12
95 0.12
96 0.13
97 0.13
98 0.12
99 0.13
100 0.16
101 0.15
102 0.14
103 0.14
104 0.13
105 0.12
106 0.13
107 0.11
108 0.08
109 0.09
110 0.09
111 0.1
112 0.1
113 0.1
114 0.1
115 0.11
116 0.12
117 0.1
118 0.11
119 0.11
120 0.13
121 0.15
122 0.14
123 0.14
124 0.2
125 0.22
126 0.21
127 0.2
128 0.18
129 0.18
130 0.21
131 0.2
132 0.15
133 0.16
134 0.21
135 0.25
136 0.24
137 0.27
138 0.28
139 0.36
140 0.43
141 0.47
142 0.46
143 0.44
144 0.45
145 0.42
146 0.39
147 0.36
148 0.3
149 0.25
150 0.23
151 0.24
152 0.22
153 0.22
154 0.22
155 0.18
156 0.18
157 0.23
158 0.25
159 0.26
160 0.27
161 0.3
162 0.31
163 0.3
164 0.27
165 0.22
166 0.18
167 0.16
168 0.17
169 0.12
170 0.12
171 0.13
172 0.12
173 0.12
174 0.11
175 0.1
176 0.08
177 0.09
178 0.13
179 0.13
180 0.14
181 0.13
182 0.15
183 0.16
184 0.16
185 0.15
186 0.1
187 0.09
188 0.11
189 0.11
190 0.12
191 0.11
192 0.1
193 0.11
194 0.11
195 0.13
196 0.12
197 0.11
198 0.1
199 0.1
200 0.1
201 0.1
202 0.1
203 0.09
204 0.08
205 0.08
206 0.08
207 0.07
208 0.07
209 0.08
210 0.08
211 0.07
212 0.07
213 0.1
214 0.12
215 0.15
216 0.15
217 0.15
218 0.16
219 0.18
220 0.2
221 0.17
222 0.18
223 0.15
224 0.19
225 0.22
226 0.21
227 0.19
228 0.17
229 0.16
230 0.19
231 0.25
232 0.26
233 0.28
234 0.32
235 0.35
236 0.42
237 0.43
238 0.39
239 0.4
240 0.36
241 0.32
242 0.32
243 0.3
244 0.23
245 0.24
246 0.23
247 0.18
248 0.19
249 0.19
250 0.16
251 0.16
252 0.16
253 0.16
254 0.15
255 0.17
256 0.17
257 0.16
258 0.15
259 0.15
260 0.15
261 0.14
262 0.14
263 0.1
264 0.09
265 0.08
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.06
274 0.06
275 0.06
276 0.06
277 0.05
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.06
284 0.06
285 0.06
286 0.06
287 0.08
288 0.08
289 0.1
290 0.09
291 0.09
292 0.11
293 0.14
294 0.15
295 0.14
296 0.13
297 0.12
298 0.13
299 0.16
300 0.14
301 0.11
302 0.14
303 0.15
304 0.15
305 0.16
306 0.14
307 0.12
308 0.12
309 0.11
310 0.08
311 0.1
312 0.13
313 0.18
314 0.19
315 0.2
316 0.21
317 0.24
318 0.24
319 0.23
320 0.22
321 0.22
322 0.24
323 0.27
324 0.25
325 0.24
326 0.27
327 0.26
328 0.27
329 0.23
330 0.2
331 0.16
332 0.16
333 0.15
334 0.1
335 0.11
336 0.08
337 0.08
338 0.12
339 0.12
340 0.14
341 0.14
342 0.14
343 0.12
344 0.12
345 0.12
346 0.09
347 0.09
348 0.08
349 0.08
350 0.08
351 0.1
352 0.13
353 0.11
354 0.13
355 0.14
356 0.16
357 0.17
358 0.17
359 0.2
360 0.23
361 0.27
362 0.29
363 0.29
364 0.29
365 0.33
366 0.35
367 0.35
368 0.33
369 0.29
370 0.26
371 0.27
372 0.32
373 0.3
374 0.28
375 0.26
376 0.25
377 0.25
378 0.26
379 0.24
380 0.18
381 0.15
382 0.15
383 0.13
384 0.12
385 0.12
386 0.13
387 0.14
388 0.14
389 0.21
390 0.21
391 0.24
392 0.26
393 0.32
394 0.36
395 0.36
396 0.39
397 0.36
398 0.43
399 0.44
400 0.44
401 0.41
402 0.37
403 0.36
404 0.36
405 0.36
406 0.27
407 0.24
408 0.23
409 0.23
410 0.25
411 0.26
412 0.25
413 0.25
414 0.26
415 0.26
416 0.26
417 0.24
418 0.24
419 0.27
420 0.32
421 0.34
422 0.38
423 0.41
424 0.42
425 0.43
426 0.42
427 0.37
428 0.32
429 0.26
430 0.2
431 0.16
432 0.15
433 0.12
434 0.1
435 0.1
436 0.11
437 0.14
438 0.16
439 0.17
440 0.16
441 0.16
442 0.19
443 0.2
444 0.2
445 0.18
446 0.16
447 0.16
448 0.17
449 0.16
450 0.12
451 0.11
452 0.09
453 0.08
454 0.08
455 0.07
456 0.07
457 0.08
458 0.07
459 0.06
460 0.06
461 0.06
462 0.06