FuNGI

B2ABB1

Protein Details

Accession

B2ABB1

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
59-84	RVYRAGRKMTIKKKNTQDRGKPPLPG	Hydrophilic

NLS Segment(s)

Position	Sequence
62-92	RAGRKMTIKKKNTQDRGKPPLPGERKAFRKK

Subcellular Location(s)

mito 23, cyto_mito 13.833, cyto_nucl 2.666

Family & Domain DBs

InterPro	View protein in InterPro IPR019368 Ribosomal_S23/S29_mit IPR017082 Ribosomal_S23_mit_fun
Gene Ontology	GO:0005763 C:mitochondrial small ribosomal subunit GO:0032543 P:mitochondrial translation
KEGG	pan:PODANSg09940 -
Pfam	View protein in Pfam PF10236 DAP3

Amino Acid Sequences

MSASNCLRCLGRPSVAGASRGVVVPVFAPRTAAPFSTTAVQNALPAKPKSAEHQDRSVRVYRAGRKMTIKKKNTQDRGKPPLPGERKAFRKKIVLSNDNAFPVPWVTEMEASSLSNENKVGSIVSLPPALQDQLRATEAFQPTQTWGLFRKPSTLIRKETVGLTGKMEKAVENKQTARIVLAGEKISGKSTMLLQAQSHAYLNNWIVIHFPDAQELTNGSTEYAPIPNTENPTLYMQQNYCLKLLQSIKKANEKILAKLLSVSNHNELPQNITVNQPLLSLINAAKEAEGAWSVFQALWSELNAQGVNRPPILLSMDNLPHIMKMSEYRSASFDKIHSHDLSLVRLFTEALAGNTRFPSGGAVIAATNRNNGPRIPSMELALKQRLAEQIKVVEGEEAPEPPVRDPYFKGYDDRVEKVLKTVEVIEVNKIGKREARSLMEYWAASGLLRTTVDEQVVSEKWTLGGCGVLGEMERAALLTMKI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.41
3	0.4
4	0.34
5	0.3
6	0.27
7	0.26
8	0.22
9	0.13
10	0.11
11	0.11
12	0.15
13	0.15
14	0.14
15	0.16
16	0.16
17	0.2
18	0.22
19	0.21
20	0.19
21	0.18
22	0.2
23	0.24
24	0.25
25	0.22
26	0.22
27	0.21
28	0.22
29	0.24
30	0.26
31	0.27
32	0.27
33	0.29
34	0.3
35	0.31
36	0.35
37	0.43
38	0.5
39	0.48
40	0.57
41	0.61
42	0.61
43	0.65
44	0.65
45	0.56
46	0.53
47	0.56
48	0.55
49	0.57
50	0.58
51	0.58
52	0.61
53	0.69
54	0.73
55	0.75
56	0.73
57	0.73
58	0.79
59	0.84
60	0.85
61	0.85
62	0.85
63	0.85
64	0.88
65	0.83
66	0.78
67	0.71
68	0.71
69	0.66
70	0.62
71	0.59
72	0.58
73	0.63
74	0.68
75	0.7
76	0.65
77	0.67
78	0.67
79	0.69
80	0.7
81	0.66
82	0.61
83	0.6
84	0.58
85	0.51
86	0.45
87	0.35
88	0.26
89	0.21
90	0.17
91	0.13
92	0.11
93	0.1
94	0.12
95	0.12
96	0.13
97	0.13
98	0.12
99	0.13
100	0.16
101	0.15
102	0.14
103	0.14
104	0.13
105	0.12
106	0.13
107	0.11
108	0.08
109	0.09
110	0.09
111	0.1
112	0.1
113	0.1
114	0.1
115	0.11
116	0.12
117	0.1
118	0.11
119	0.11
120	0.13
121	0.15
122	0.14
123	0.14
124	0.2
125	0.22
126	0.21
127	0.2
128	0.18
129	0.18
130	0.21
131	0.2
132	0.15
133	0.16
134	0.21
135	0.25
136	0.24
137	0.27
138	0.28
139	0.36
140	0.43
141	0.47
142	0.46
143	0.44
144	0.45
145	0.42
146	0.39
147	0.36
148	0.3
149	0.25
150	0.23
151	0.24
152	0.22
153	0.22
154	0.22
155	0.18
156	0.18
157	0.23
158	0.25
159	0.26
160	0.27
161	0.3
162	0.31
163	0.3
164	0.27
165	0.22
166	0.18
167	0.16
168	0.17
169	0.12
170	0.12
171	0.13
172	0.12
173	0.12
174	0.11
175	0.1
176	0.08
177	0.09
178	0.13
179	0.13
180	0.14
181	0.13
182	0.15
183	0.16
184	0.16
185	0.15
186	0.1
187	0.09
188	0.11
189	0.11
190	0.12
191	0.11
192	0.1
193	0.11
194	0.11
195	0.13
196	0.12
197	0.11
198	0.1
199	0.1
200	0.1
201	0.1
202	0.1
203	0.09
204	0.08
205	0.08
206	0.08
207	0.07
208	0.07
209	0.08
210	0.08
211	0.07
212	0.07
213	0.1
214	0.12
215	0.15
216	0.15
217	0.15
218	0.16
219	0.18
220	0.2
221	0.17
222	0.18
223	0.15
224	0.19
225	0.22
226	0.21
227	0.19
228	0.17
229	0.16
230	0.19
231	0.25
232	0.26
233	0.28
234	0.32
235	0.35
236	0.42
237	0.43
238	0.39
239	0.4
240	0.36
241	0.32
242	0.32
243	0.3
244	0.23
245	0.24
246	0.23
247	0.18
248	0.19
249	0.19
250	0.16
251	0.16
252	0.16
253	0.16
254	0.15
255	0.17
256	0.17
257	0.16
258	0.15
259	0.15
260	0.15
261	0.14
262	0.14
263	0.1
264	0.09
265	0.08
266	0.07
267	0.07
268	0.07
269	0.07
270	0.07
271	0.07
272	0.07
273	0.06
274	0.06
275	0.06
276	0.06
277	0.05
278	0.05
279	0.05
280	0.05
281	0.05
282	0.05
283	0.06
284	0.06
285	0.06
286	0.06
287	0.08
288	0.08
289	0.1
290	0.09
291	0.09
292	0.11
293	0.14
294	0.15
295	0.14
296	0.13
297	0.12
298	0.13
299	0.16
300	0.14
301	0.11
302	0.14
303	0.15
304	0.15
305	0.16
306	0.14
307	0.12
308	0.12
309	0.11
310	0.08
311	0.1
312	0.13
313	0.18
314	0.19
315	0.2
316	0.21
317	0.24
318	0.24
319	0.23
320	0.22
321	0.22
322	0.24
323	0.27
324	0.25
325	0.24
326	0.27
327	0.26
328	0.27
329	0.23
330	0.2
331	0.16
332	0.16
333	0.15
334	0.1
335	0.11
336	0.08
337	0.08
338	0.12
339	0.12
340	0.14
341	0.14
342	0.14
343	0.12
344	0.12
345	0.12
346	0.09
347	0.09
348	0.08
349	0.08
350	0.08
351	0.1
352	0.13
353	0.11
354	0.13
355	0.14
356	0.16
357	0.17
358	0.17
359	0.2
360	0.23
361	0.27
362	0.29
363	0.29
364	0.29
365	0.33
366	0.35
367	0.35
368	0.33
369	0.29
370	0.26
371	0.27
372	0.32
373	0.3
374	0.28
375	0.26
376	0.25
377	0.25
378	0.26
379	0.24
380	0.18
381	0.15
382	0.15
383	0.13
384	0.12
385	0.12
386	0.13
387	0.14
388	0.14
389	0.21
390	0.21
391	0.24
392	0.26
393	0.32
394	0.36
395	0.36
396	0.39
397	0.36
398	0.43
399	0.44
400	0.44
401	0.41
402	0.37
403	0.36
404	0.36
405	0.36
406	0.27
407	0.24
408	0.23
409	0.23
410	0.25
411	0.26
412	0.25
413	0.25
414	0.26
415	0.26
416	0.26
417	0.24
418	0.24
419	0.27
420	0.32
421	0.34
422	0.38
423	0.41
424	0.42
425	0.43
426	0.42
427	0.37
428	0.32
429	0.26
430	0.2
431	0.16
432	0.15
433	0.12
434	0.1
435	0.1
436	0.11
437	0.14
438	0.16
439	0.17
440	0.16
441	0.16
442	0.19
443	0.2
444	0.2
445	0.18
446	0.16
447	0.16
448	0.17
449	0.16
450	0.12
451	0.11
452	0.09
453	0.08
454	0.08
455	0.07
456	0.07
457	0.08
458	0.07
459	0.06
460	0.06
461	0.06
462	0.06

B2ABB1

3D AlphaFold-predicted Structure Viewer