Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6MNJ1

Protein Details
Accession W6MNJ1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
74-93EIRSKFKRKRGKFDSVFSRLHydrophilic
NLS Segment(s)
PositionSequence
79-83FKRKR
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015033  HBS1-like_N  
Pfam View protein in Pfam  
PF08938  HBS1_N  
Amino Acid Sequences MPYDDDDYVDYENEDYDDSEFVEDNLNDEDYALLYETLPVLKDQLGDYNSDIQDEDLKAVLYYNYFEVDNALAEIRSKFKRKRGKFDSVFSRLFDFSFDSPGICVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.08
9 0.12
10 0.11
11 0.11
12 0.12
13 0.12
14 0.11
15 0.11
16 0.11
17 0.07
18 0.08
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.1
32 0.11
33 0.11
34 0.12
35 0.16
36 0.15
37 0.15
38 0.15
39 0.11
40 0.12
41 0.11
42 0.1
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.05
60 0.07
61 0.08
62 0.12
63 0.17
64 0.24
65 0.3
66 0.39
67 0.5
68 0.57
69 0.68
70 0.71
71 0.77
72 0.76
73 0.79
74 0.8
75 0.76
76 0.7
77 0.6
78 0.55
79 0.45
80 0.38
81 0.31
82 0.25
83 0.19
84 0.21
85 0.19
86 0.16