Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6MKS5

Protein Details
Accession W6MKS5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
16-40AMAGGKKSKKKWSKGKNAKDKAQHAHydrophilic
NLS Segment(s)
PositionSequence
11-36AKAAAAMAGGKKSKKKWSKGKNAKDK
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGGKKSKKKWSKGKNAKDKAQHAVILDQEKYDRIMKDVPTFRYVSVSVLVDRLKIGGSMARVALRQLEREGIIKPVLNHSKQQIYTRASASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.3
10 0.39
11 0.47
12 0.56
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.91
19 0.9
20 0.87
21 0.85
22 0.78
23 0.72
24 0.64
25 0.55
26 0.44
27 0.38
28 0.33
29 0.27
30 0.23
31 0.18
32 0.15
33 0.13
34 0.14
35 0.15
36 0.13
37 0.12
38 0.15
39 0.16
40 0.23
41 0.27
42 0.27
43 0.27
44 0.27
45 0.26
46 0.25
47 0.23
48 0.17
49 0.15
50 0.13
51 0.11
52 0.12
53 0.12
54 0.1
55 0.1
56 0.09
57 0.07
58 0.07
59 0.07
60 0.06
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.15
68 0.15
69 0.16
70 0.16
71 0.17
72 0.17
73 0.19
74 0.2
75 0.17
76 0.17
77 0.18
78 0.17
79 0.25
80 0.31
81 0.32
82 0.35
83 0.38
84 0.44
85 0.46
86 0.5
87 0.49
88 0.46
89 0.48