Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2ALK6

Protein Details
Accession B2ALK6   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
71-90KSEGRKGGSNKNKKGKKAGSBasic
NLS Segment(s)
PositionSequence
47-88KRKVKKKGGEGSKTGKKCKDTKGMKSEGRKGGSNKNKKGKKA
Subcellular Location(s) nucl 21.5, cyto_nucl 12.333, mito 2, cyto 2
Family & Domain DBs
KEGG pan:PODANSg1959  -  
Amino Acid Sequences MRKIKKKNKDYFDSDESEADDSEETESKDQTETEEDSDEEEPDEQDKRKVKKKGGEGSKTGKKCKDTKGMKSEGRKGGSNKNKKGKKAGSDEDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.53
3 0.45
4 0.37
5 0.29
6 0.21
7 0.15
8 0.11
9 0.11
10 0.11
11 0.11
12 0.11
13 0.11
14 0.11
15 0.12
16 0.11
17 0.11
18 0.13
19 0.13
20 0.13
21 0.14
22 0.13
23 0.15
24 0.15
25 0.14
26 0.11
27 0.1
28 0.09
29 0.09
30 0.11
31 0.1
32 0.14
33 0.2
34 0.26
35 0.33
36 0.39
37 0.44
38 0.49
39 0.57
40 0.62
41 0.65
42 0.65
43 0.62
44 0.64
45 0.66
46 0.64
47 0.6
48 0.55
49 0.51
50 0.52
51 0.54
52 0.57
53 0.57
54 0.62
55 0.66
56 0.7
57 0.71
58 0.73
59 0.74
60 0.71
61 0.66
62 0.61
63 0.57
64 0.59
65 0.63
66 0.66
67 0.67
68 0.7
69 0.73
70 0.74
71 0.8
72 0.78
73 0.77
74 0.76
75 0.76
76 0.71
77 0.71