Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5ETG1

Protein Details
Accession V5ETG1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-162DPETPVPKPKKDKNGKEIKABasic
NLS Segment(s)
PositionSequence
150-158KPKKDKNGK
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cyto 9, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF13508  Acetyltransf_7  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MSAAAASSSSSPWPLPPMSYEPRPAAPVRSLLPKRIDVAQLTPNNLGQLRKLNSVLFPVQYSERFYKDVLLPDAAEVCKLGLFNDVAVGTICCRLEHVSKDVVRIYIMTLGVLAPYRRLGIASALLQHVLDHVSPGKEIQIIDPETPVPKPKKDKNGKEIKAELVKKTVKVDSIYLHVQTSNDEARVFYEKFGFKVAETIESYYRRIQPASAWVLRLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.21
4 0.27
5 0.32
6 0.36
7 0.4
8 0.39
9 0.4
10 0.43
11 0.4
12 0.36
13 0.32
14 0.31
15 0.29
16 0.37
17 0.37
18 0.39
19 0.42
20 0.4
21 0.4
22 0.4
23 0.4
24 0.32
25 0.33
26 0.36
27 0.34
28 0.35
29 0.34
30 0.3
31 0.29
32 0.29
33 0.25
34 0.19
35 0.24
36 0.24
37 0.26
38 0.27
39 0.26
40 0.25
41 0.29
42 0.28
43 0.21
44 0.18
45 0.17
46 0.18
47 0.19
48 0.22
49 0.21
50 0.21
51 0.22
52 0.21
53 0.23
54 0.23
55 0.27
56 0.24
57 0.22
58 0.2
59 0.19
60 0.21
61 0.17
62 0.14
63 0.09
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.08
78 0.08
79 0.06
80 0.07
81 0.09
82 0.12
83 0.14
84 0.16
85 0.2
86 0.2
87 0.22
88 0.22
89 0.2
90 0.18
91 0.15
92 0.13
93 0.1
94 0.09
95 0.07
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.08
109 0.08
110 0.09
111 0.09
112 0.09
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.05
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.09
126 0.09
127 0.13
128 0.15
129 0.15
130 0.15
131 0.15
132 0.15
133 0.16
134 0.22
135 0.2
136 0.25
137 0.34
138 0.41
139 0.51
140 0.61
141 0.7
142 0.73
143 0.81
144 0.79
145 0.77
146 0.72
147 0.68
148 0.66
149 0.6
150 0.51
151 0.48
152 0.45
153 0.4
154 0.41
155 0.37
156 0.31
157 0.29
158 0.3
159 0.24
160 0.26
161 0.27
162 0.24
163 0.23
164 0.21
165 0.19
166 0.18
167 0.2
168 0.18
169 0.16
170 0.15
171 0.15
172 0.17
173 0.22
174 0.22
175 0.19
176 0.23
177 0.23
178 0.24
179 0.27
180 0.25
181 0.19
182 0.23
183 0.23
184 0.21
185 0.22
186 0.24
187 0.27
188 0.28
189 0.31
190 0.33
191 0.36
192 0.34
193 0.33
194 0.31
195 0.29
196 0.36
197 0.41
198 0.38