Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B5B4

Protein Details
Accession B2B5B4   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-110LLTFSPRRGPPRSRRVLRRRWRWRRBasic
NLS Segment(s)
PositionSequence
91-110PRRGPPRSRRVLRRRWRWRR
Subcellular Location(s) extr 10, nucl 6, plas 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008427  Extracellular_membr_CFEM_dom  
Gene Ontology GO:0016020  C:membrane  
KEGG pan:PODANSg8206  -  
Pfam View protein in Pfam  
PF05730  CFEM  
Amino Acid Sequences MKYTAALLALAAAVSAQDISIFPECSLDCIISGIGSGTSCELTDFACVCENTQSLITSATPCVLEACGADVALSTPPSPIPIPPPLLTFSPRRGPPRSRRVLRRRWRWRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.07
7 0.09
8 0.1
9 0.1
10 0.12
11 0.12
12 0.14
13 0.15
14 0.12
15 0.1
16 0.1
17 0.1
18 0.07
19 0.07
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.07
31 0.07
32 0.07
33 0.09
34 0.09
35 0.09
36 0.11
37 0.11
38 0.1
39 0.1
40 0.1
41 0.08
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.07
50 0.06
51 0.06
52 0.05
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.07
61 0.05
62 0.06
63 0.06
64 0.08
65 0.09
66 0.09
67 0.13
68 0.17
69 0.21
70 0.21
71 0.23
72 0.24
73 0.26
74 0.28
75 0.28
76 0.29
77 0.33
78 0.38
79 0.43
80 0.48
81 0.55
82 0.63
83 0.7
84 0.75
85 0.77
86 0.82
87 0.86
88 0.9
89 0.91
90 0.92