Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5ELG0

Protein Details
Accession V5ELG0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
143-162EIDTLKKQTKQQQQEYNRLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, E.R. 6, golg 6, plas 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008417  BAP29/BAP31  
IPR040463  BAP29/BAP31_N  
IPR041672  Bap31/Bap29_C  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0006886  P:intracellular protein transport  
GO:0070973  P:protein localization to endoplasmic reticulum exit site  
Pfam View protein in Pfam  
PF05529  Bap31  
PF18035  Bap31_Bap29_C  
Amino Acid Sequences MAMFMVLIVPLPFTWRRKLFHFLAVNPVVAKIQYGLKITFIFVAVLFVDAVQRMVKVMSEGETARDNRGVQDVRTETNYAARKFYSQRNMYLTGFTLFLSLILSRTYSLILDLINTQEELVALKKGSKTAGSGADIEKKYQTEIDTLKKQTKQQQQEYNRLSDELAKATGQTSTKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.36
4 0.4
5 0.48
6 0.47
7 0.51
8 0.53
9 0.46
10 0.5
11 0.48
12 0.44
13 0.36
14 0.34
15 0.25
16 0.18
17 0.17
18 0.09
19 0.11
20 0.14
21 0.16
22 0.16
23 0.17
24 0.18
25 0.18
26 0.17
27 0.14
28 0.11
29 0.09
30 0.09
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.09
47 0.09
48 0.1
49 0.14
50 0.15
51 0.15
52 0.17
53 0.16
54 0.14
55 0.2
56 0.19
57 0.15
58 0.21
59 0.21
60 0.2
61 0.22
62 0.22
63 0.17
64 0.22
65 0.27
66 0.22
67 0.22
68 0.21
69 0.22
70 0.25
71 0.31
72 0.33
73 0.3
74 0.32
75 0.34
76 0.37
77 0.35
78 0.32
79 0.27
80 0.19
81 0.17
82 0.14
83 0.1
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.05
95 0.06
96 0.06
97 0.05
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.05
105 0.06
106 0.06
107 0.06
108 0.07
109 0.06
110 0.09
111 0.1
112 0.11
113 0.12
114 0.12
115 0.13
116 0.15
117 0.19
118 0.18
119 0.2
120 0.21
121 0.28
122 0.27
123 0.27
124 0.26
125 0.22
126 0.22
127 0.22
128 0.21
129 0.18
130 0.23
131 0.3
132 0.35
133 0.39
134 0.45
135 0.48
136 0.53
137 0.57
138 0.63
139 0.65
140 0.67
141 0.73
142 0.74
143 0.81
144 0.79
145 0.74
146 0.65
147 0.55
148 0.46
149 0.41
150 0.35
151 0.27
152 0.24
153 0.2
154 0.19
155 0.19
156 0.22
157 0.2