Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5E5D0

Protein Details
Accession V5E5D0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-26AERVTLRKRNPYNTKSARRQVVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MMMAERVTLRKRNPYNTKSARRQVVKTPGGHLRYLHVQKRGTVPKCGDCHSDLSGIKAHRPREFGTISKRQKTVSRAYGGSRCSSCVRTRIIRAFLVEEAKIVKNVLKAQAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.75
4 0.81
5 0.8
6 0.82
7 0.8
8 0.76
9 0.74
10 0.72
11 0.72
12 0.68
13 0.6
14 0.56
15 0.55
16 0.51
17 0.48
18 0.4
19 0.33
20 0.35
21 0.41
22 0.41
23 0.39
24 0.37
25 0.38
26 0.46
27 0.52
28 0.46
29 0.44
30 0.43
31 0.44
32 0.45
33 0.45
34 0.39
35 0.31
36 0.32
37 0.27
38 0.29
39 0.21
40 0.2
41 0.22
42 0.19
43 0.22
44 0.23
45 0.25
46 0.23
47 0.25
48 0.26
49 0.27
50 0.29
51 0.29
52 0.33
53 0.4
54 0.44
55 0.47
56 0.46
57 0.43
58 0.46
59 0.48
60 0.48
61 0.45
62 0.43
63 0.39
64 0.43
65 0.45
66 0.42
67 0.41
68 0.33
69 0.29
70 0.28
71 0.29
72 0.28
73 0.29
74 0.33
75 0.34
76 0.41
77 0.45
78 0.46
79 0.45
80 0.43
81 0.41
82 0.38
83 0.35
84 0.28
85 0.22
86 0.21
87 0.21
88 0.19
89 0.17
90 0.17
91 0.18
92 0.23
93 0.31