Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5EXC2

Protein Details
Accession V5EXC2   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
191-213QEFYRWCRTERERQERIKQDQDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024789  APC4  
IPR024790  APC4_long_dom  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF12896  ANAPC4  
Amino Acid Sequences MATSVHQLRLPLPFNTRYGPLDSRRKVAAISRTSHLLRFYLGYALDAASASQQVYQHELLQKVTTEWTKNIDDLSLKFGGDMRYELINVLLTGRAGPAAEQFLLGNLTEGVLTRLEKQSHTATYALKRLISDSLRPALERCIVCMTGLLGQVRFLGESDGKLRAALRILHAALDSTLSLAKEVDLEALFSQEFYRWCRTERERQERIKQDQDEPRLPITYDVHYVASYIDRGFKNEQIHARMGNDLPAEASQEPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.38
4 0.33
5 0.36
6 0.39
7 0.42
8 0.49
9 0.49
10 0.5
11 0.49
12 0.47
13 0.43
14 0.43
15 0.44
16 0.39
17 0.4
18 0.39
19 0.42
20 0.43
21 0.43
22 0.38
23 0.29
24 0.24
25 0.21
26 0.2
27 0.17
28 0.16
29 0.14
30 0.13
31 0.12
32 0.11
33 0.09
34 0.08
35 0.06
36 0.07
37 0.06
38 0.08
39 0.09
40 0.1
41 0.14
42 0.15
43 0.18
44 0.22
45 0.23
46 0.22
47 0.22
48 0.21
49 0.18
50 0.21
51 0.21
52 0.19
53 0.19
54 0.23
55 0.23
56 0.23
57 0.22
58 0.2
59 0.18
60 0.17
61 0.2
62 0.16
63 0.15
64 0.14
65 0.16
66 0.16
67 0.14
68 0.14
69 0.11
70 0.11
71 0.11
72 0.11
73 0.1
74 0.08
75 0.08
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.06
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.08
101 0.11
102 0.12
103 0.12
104 0.15
105 0.18
106 0.18
107 0.19
108 0.18
109 0.17
110 0.19
111 0.22
112 0.2
113 0.18
114 0.17
115 0.16
116 0.18
117 0.17
118 0.16
119 0.15
120 0.17
121 0.17
122 0.17
123 0.17
124 0.15
125 0.19
126 0.18
127 0.17
128 0.16
129 0.16
130 0.15
131 0.15
132 0.14
133 0.1
134 0.12
135 0.11
136 0.09
137 0.09
138 0.09
139 0.09
140 0.08
141 0.06
142 0.06
143 0.06
144 0.07
145 0.09
146 0.1
147 0.1
148 0.11
149 0.11
150 0.1
151 0.12
152 0.12
153 0.12
154 0.14
155 0.14
156 0.14
157 0.14
158 0.13
159 0.11
160 0.1
161 0.08
162 0.05
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.06
172 0.07
173 0.07
174 0.08
175 0.08
176 0.08
177 0.08
178 0.09
179 0.11
180 0.14
181 0.2
182 0.21
183 0.23
184 0.32
185 0.38
186 0.47
187 0.56
188 0.63
189 0.65
190 0.72
191 0.8
192 0.81
193 0.82
194 0.8
195 0.73
196 0.72
197 0.72
198 0.71
199 0.66
200 0.59
201 0.54
202 0.46
203 0.43
204 0.38
205 0.32
206 0.27
207 0.25
208 0.23
209 0.22
210 0.2
211 0.2
212 0.17
213 0.15
214 0.14
215 0.12
216 0.17
217 0.17
218 0.21
219 0.24
220 0.29
221 0.32
222 0.37
223 0.43
224 0.41
225 0.43
226 0.42
227 0.4
228 0.38
229 0.35
230 0.32
231 0.26
232 0.21
233 0.2
234 0.18
235 0.2
236 0.16